Diaphorina citri psyllid: psy12608

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-----
MSSDDAGASAGVVVDVVLYPLDTIKTRLQSQYGFWRSGGFKAIYKGLGPAAISSPIQEYTVIVVF
ccccHHHHHHHHHHHcccccHHHHHHHHHcccccHHcccccccccccHHHHHHHHHHccEEEEEc
**SDDAGASAGVVVDVVLYPLDTIKTRLQSQYGFWRSGGFKAIYKGLGPAAISSPIQEYTVIVVF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSDDAGASAGVVVDVVLYPLDTIKTRLQSQYGFWRSGGFKAIYKGLGPAAISSPIQEYTVIVVF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
S-adenosylmethionine mitochondrial carrier protein Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. Specifically mediates the transport of S-adenosylmethionine (SAM) into the mitochondria.confidentQ6GLA2
S-adenosylmethionine mitochondrial carrier protein Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. Specifically mediates the transport of S-adenosylmethionine (SAM) into the mitochondria.confidentQ5U680
S-adenosylmethionine mitochondrial carrier protein homolog Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May mediate the transport of S-adenosylmethionine (SAM) into the mitochondria.confidentQ9VBN7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:1901962 [BP]S-adenosyl-L-methionine transmembrane transportprobableGO:0015931, GO:0006865, GO:0015858, GO:0006820, GO:0072337, GO:0044699, GO:1901264, GO:0051181, GO:0051182, GO:0051179, GO:0071705, GO:0071702, GO:0072530, GO:0006810, GO:0015849, GO:0006811, GO:1901642, GO:0015711, GO:0015860, GO:0034220, GO:0044765, GO:0044763, GO:0051234, GO:0055085, GO:0046942, GO:0015805, GO:0003333, GO:0072348, GO:0008150, GO:0009987
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0022857 [MF]transmembrane transporter activityprobableGO:0005215, GO:0003674

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 2-65
View the alignment between query and template
View the model in PyMOL