Diaphorina citri psyllid: psy12631


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MAINVYSTNVTSENLSRHDMLHWVNDTLQSSFGKIEELCSGAAYCQFMDMLFPGLYSIFILRNLLHTFVLHLILKAQQDSKNRRAKGYGYLGIWTAWHFVAVIYHRIRIGTYLPTHLLVLLGLVDNRYLGIWTAWHFVAVIYHRIRIGTYLPTRTHLLVLLGLVDNRLGYTVESLSVFLDGGKLS
ccEEEEEcccccccccHHHHHHHHHHHHccccHHHHHHccccHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccEEcHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEcccccc
MAINVYSTNVTSENLSRHDMLHWVNDTLQSSFGKIEELCSGAAYCQFMDMLFPGLYSIFILRNLLHTFVLHLILKAQQDSKNRRAKGYGYLGIWTAWHFVAVIYHRIRIGTYLPTHLLVLLGLVDNRYLGIWTAWHFVAVIYHRIRIGTYLPTRTHL*********************LDGG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAINVYSTNVTSENLSRHDMLHWVNDTLQSSFGKIEELCSGAAYCQFMDMLFPGLYSIFILRNLLHTFVLHLILKAQQDSKNRRAKGYGYLGIWTAWHFVAVIYHRIRIGTYLPTHLLVLLGLVDNRYLGIWTAWHFVAVIYHRIRIGTYLPTRTHLLVLLGLVDNRLGYTVESLSVFLDGGKLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Microtubule-associated protein RP/EB family member 1 Binds to the plus end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes cytoplasmic microtubule nucleation and elongation. May be involved in spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration.confidentQ66HR2
Microtubule-associated protein RP/EB family member 1 Binds to the plus end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes cytoplasmic microtubule nucleation and elongation. May be involved in spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration.confidentQ15691
Microtubule-associated protein RP/EB family member 1 Binds to the plus end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes cytoplasmic microtubule nucleation and elongation. May be involved in spindle function by stabilizing microtubules and anchoring them at centrosomes (By similarity). May play a role in cell migration.confidentQ61166

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005881 [CC]cytoplasmic microtubuleprobableGO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0051225 [BP]spindle assemblyprobableGO:0006996, GO:0022607, GO:0007010, GO:0071822, GO:0070271, GO:0043933, GO:0071840, GO:0006461, GO:0044763, GO:0016043, GO:0065003, GO:0007051, GO:0044085, GO:0000226, GO:0044699, GO:0008150, GO:0022402, GO:0009987, GO:0070925, GO:0007049, GO:0007017
GO:0031253 [CC]cell projection membraneprobableGO:0016020, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0042995, GO:0044459
GO:0007059 [BP]chromosome segregationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0005876 [CC]spindle microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0051010 [MF]microtubule plus-end bindingprobableGO:0015631, GO:0008092, GO:0008017, GO:0003674, GO:0005488, GO:0005515
GO:0030981 [CC]cortical microtubule cytoskeletonprobableGO:0005856, GO:0005737, GO:0015630, GO:0043228, GO:0005575, GO:0043232, GO:0030863, GO:0044444, GO:0071944, GO:0044422, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005938, GO:0044424, GO:0044464, GO:0043226, GO:0044448
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0035371 [CC]microtubule plus endprobableGO:0005856, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0035372 [BP]protein localization to microtubuleprobableGO:0008104, GO:0070727, GO:0034613, GO:0044380, GO:0072698, GO:0044763, GO:0033365, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0030496 [CC]midbodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0031115 [BP]negative regulation of microtubule polymerizationprobableGO:0031110, GO:0031111, GO:0031113, GO:0033043, GO:0051129, GO:0051128, GO:0032886, GO:0050789, GO:0044699, GO:0051494, GO:0051493, GO:0065007, GO:0032271, GO:0032272, GO:0048519, GO:0031333, GO:0009987, GO:0050794, GO:0044763, GO:0043254, GO:0010639, GO:0044087, GO:0008150, GO:0070507, GO:0048523
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R8U, chain A
Confidence level:very confident
Coverage over the Query: 1-78,104-155
View the alignment between query and template
View the model in PyMOL