Diaphorina citri psyllid: psy12642

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-

MAPIVYIIGCFHFFRYEEALEHLETIIKIDETNTAARKRKICILKAKNKIPEAIKELTEYLKKFMTDQETWQELCDLYLSEGDYAKAVFCMEELFLHHPHNHLLHQRYADILYTQGGLENIELAISHYLMAINLNEKNIRALYGLALSCHQVLTSAKCSAAKKKEISKQMMWVSKHLARQYEEQQGNTETLTELMSALQVS

ccHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccc

*APIVYIIGCFHFFRYEEALEHLETIIKIDETNTAARKRKICILKAKNKIPEAIKELTEYLKKFMTDQETWQELCDLYLSEGDYAKAVFCMEELFLHHPHNHLLHQRYADILYTQGGLENIELAISHYLMAINLNEKNIRALYGLALSCHQVLTSAKCSAA******KQMMWVSKHLARQ************ELMSALQV*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ER membrane protein complex subunit 2		confident	B0BNG0
ER membrane protein complex subunit 2		confident	Q5M7J9
ER membrane protein complex subunit 2		confident	Q6TGY8

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0072546 [CC]	ER membrane protein complex	probable	GO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0030176, GO:0031301, GO:0031300, GO:0043227, GO:0031227, GO:0031224, GO:0005737, GO:0044446, GO:0031090, GO:0016021, GO:0016020, GO:0043226, GO:0044432, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016529 [CC]	sarcoplasmic reticulum	probable	GO:0005737, GO:0005783, GO:0043229, GO:0044464, GO:0016528, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W3B, chain A
Confidence level:very confident
Coverage over the Query: 7-160
View the alignment between query and template
View the model in PyMOL

Template: 1W3B, chain A
Confidence level:very confident
Coverage over the Query: 6-200
View the alignment between query and template
View the model in PyMOL