Diaphorina citri psyllid: psy12645

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22

MANWPECRDSSFKPGRDSSFKLGRDRPSYSLQAIIIIINVASSMPKIQAMDGAWYRDYSLRCEPVDYSTTPKAMRVARGCWWYFFSKFTEFFDTFFFVMRKKYDQVSTLHVIHHGVMPLSTWFGVKFTPGGHSTFFGLLNTFIQFVCILIHAFQLFFIECDYPKAFAWWIGGHAVMFYFLFSNFYKETYVKKPKKDGAAPQVTREKNGHANNSKPKTN

cccccccccccHHHHHHHccHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccCEEECcccccccccccHHHHEEEEHHHHHHHHHcccEEEEEEccccccEEEEEEEcccHHHHHHHHEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccc

*********SSF*PGRDSSFKLGRDRPSYSLQAIIIIINVASSMPKIQAMDGAWYRDYSLRCEPVDYSTTPKAMRVARGCWWYFFSKFTEFFDTFFFVMRKKYDQVSTLHVIHHGVMPLSTWFGVKFTPGGHSTFFGLLNTFIQFVCILIHAFQLFFIECDYPKAFAWWIGGHAVMFYFLFSNFYKETYV****************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Elongation of very long chain fatty acids protein 7	Condensing enzyme that catalyzes the synthesis of saturated and polyunsaturated very long chain fatty acids. Highest activity toward C18 acyl-CoAs.	confident	A0JNC4
Elongation of very long chain fatty acids protein 7	Condensing enzyme that catalyzes the synthesis of saturated and polyunsaturated very long chain fatty acids. Highest activity toward C18 acyl-CoAs.	confident	Q9D2Y9
Elongation of very long chain fatty acids protein 1	Condensing enzyme that catalyzes the synthesis of both saturated and monounsaturated very long chain fatty acids. Exhibits activity toward saturated C18 to C26 acyl-CoA substrates, with the highest activity towards C22:0 acyl-CoA. Important for saturated C24:0 and monounsaturated C24:1 sphingolipid synthesis.	confident	Q9BW60

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042761 [BP]	very long-chain fatty acid biosynthetic process	probable	GO:0006633, GO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0000038, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237
GO:0016747 [MF]	transferase activity, transferring acyl groups other than amino-acyl groups	probable	GO:0003824, GO:0016740, GO:0016746, GO:0003674
GO:0019368 [BP]	fatty acid elongation, unsaturated fatty acid	probable	GO:0006633, GO:0006631, GO:0019752, GO:0016053, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0030497, GO:0044237

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted