Diaphorina citri psyllid: psy12656

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-
MLSCISRVHRSTRLNSLTILRNLSKNSPLQFENAENGEKKLSIPQENRFMYQEFLPDPELKFRNQVREKLERSDMIKRRSVIDIPSFFVGSILSVTSADKHDPNKTRKFVGICIQKRYCGLRHEFVLRNVVDNLGIEIAYDMYDPTIHNITVLRLEKRLDDDLLYLRDALPQYSTFPFDMEPEYLLDGAPVPINDIKVKLKPRPWVGRWERKGYKGIDDVDQHITEKMKGQKKKLEEPWEKYDLMKEYRRTIPEEEQEEIFSEVFSELHQLSLSNKKLKKSRVYVKPKKTG
ccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEccccccccEEEEEEEEECccccccEEEEEEEcccEEEEEEEEcccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
**************************************************Y**F******KFRNQVREKLERSDMIKRRSVIDIPSFFVGSILSVTSADKHDPNKTRKFVGICIQKRYCGLRHEFVLRNVVDNLGIEIAYDMYDPTIHNITVLRLEKRLDDDLLYLRDALPQYSTFPFDMEPEYLLDGAPVPINDIKVKLKPRPWVGRWERKGYKGIDDVDQHITEKMKGQKKKLEEPWEKYDLMKEYRRTIPEEEQEEIFSEV***************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSCISRVHRSTRLNSLTILRNLSKNSPLQFENAENGEKKLSIPQENRFMYQEFLPDPELKFRNQVREKLERSDMIKRRSVIDIPSFFVGSILSVTSADKHDPNKTRKFVGICIQKRYCGLRHEFVLRNVVDNLGIEIAYDMYDPTIHNITVLRLEKRLDDDLLYLRDALPQYSTFPFDMEPEYLLDGAPVPINDIKVKLKPRPWVGRWERKGYKGIDDVDQHITEKMKGQKKKLEEPWEKYDLMKEYRRTIPEEEQEEIFSEVFSELHQLSLSNKKLKKSRVYVKPKKTG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
39S ribosomal protein L19, mitochondrial very confidentQ9VHN6
Probable 39S ribosomal protein L19, mitochondrial confidentQ95Y83
39S ribosomal protein L19, mitochondrial confidentP49406

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0031965 [CC]nuclear membraneprobableGO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0008150 [BP]biological_processprobable

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain R
Confidence level:very confident
Coverage over the Query: 65-177
View the alignment between query and template
View the model in PyMOL