Diaphorina citri psyllid: psy12657


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260
MIKRRSVIDIPSFFVGSILSVTSADKHDPNKTRKFVGICIQKRYCGLRHEFVLRNVVDNLGIEIAYDLYDPTIHNITVLRLEKRLDDDLLYLRDALPNVVDNLGIEIAYDMYDPTIHNITVLRLEKRLDDDLLYLRDALPQYSTFPFDMEPEYLLDGAPVPINDIKVKLKPRPWVGRWERKGYKGIDDVDQHITEKMKGQKKKLEEPWEKYDLMKEYRRTIPEEEQEEIFSEVFSELHQLSLSNKKLKKSRVYVKPKKTG
cccccccccccccccccEEEEEEECccccccccEEEEEEEEECcccccEEEEEEEEcccccEEEEEEcccccccEEEEEEEcccccccHHHHHcccccccccccEEEEEccccccccHHHHHHHHHHcccccccccccccccccccccccCCcccccccccccccEEEccccccccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
******VIDIPSFFVGSILSVTSADKHDPNKTRKFVGICIQKRYCGLRHEFVLRNVVDNLGIEIAYDLYDPTIHNITVLRLEKRLDDDLLYLRDALPNVVDNLGIEIAYDMYDPTIHNITVLRLEKRLDDDLLYLRDALPQYSTFPFDMEPEYLLDGAPVPINDIKVKLKPRPWVGRWERKGYKGIDDVDQHITEKMKGQKKKLEEPWEKYDLMKEYRRTIPEEEQEEIFSEVF**************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKRRSVIDIPSFFVGSILSVTSADKHDPNKTRKFVGICIQKRYCGLRHEFVLRNVVDNLGIEIAYDLYDPTIHNITVLRLEKRLDDDLLYLRDALPNVVDNLGIEIAYDMYDPTIHNITVLRLEKRLDDDLLYLRDALPQYSTFPFDMEPEYLLDGAPVPINDIKVKLKPRPWVGRWERKGYKGIDDVDQHITEKMKGQKKKLEEPWEKYDLMKEYRRTIPEEEQEEIFSEVFSELHQLSLSNKKLKKSRVYVKPKKTG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
39S ribosomal protein L19, mitochondrial confidentQ9VHN6
Probable 39S ribosomal protein L19, mitochondrial confidentQ95Y83

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FTC, chain K
Confidence level:very confident
Coverage over the Query: 10-98
View the alignment between query and template
View the model in PyMOL
Template: 2FTC, chain K
Confidence level:confident
Coverage over the Query: 98-150
View the alignment between query and template
View the model in PyMOL