Diaphorina citri psyllid: psy12666


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------
MVTVEALRNGITPSPSSSVSESLDLFPEDSPIHFQLRCLKITPTQVDHFENDNFFVNKLIVKCQIVNPYLDSSKAFDKPCHMHELWPGPLLEIKFRPANHYQNSIRHNLSLHSKFMRVQNEGTGKSSWWMLNPDAKAGKSARRRATSMETSKFEKRRGRVKKKVEALRNGITPSPSSSVSEIRTTDSVPHPTLPPVGLIFSPDYRQRASSNASSCGRLSPIPAQESPAWLPPYSNPYLGAEQLAGSLETTMKLSSDNFLPYPSPPPPYGAPPPYPCPHHLVNSCNCHNHPAVKQQSISPSYHNSPSPSPPATVMGQVLSSLNSSVLDDFNLNIESLQGFDCNVDEVY
ccHHHHHHccccccccccccccccccccccccEEEEEEEEEccccccccccccHHHHHEEEEEEEEcccccccccccccccccccccccccccccccccccccHHHcccccccccEEcccccccccccEEEcccccccccccccccccccHHHHHHHcccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccc
**********************LDLFPEDSPIHFQLRCLKITPTQVDHFENDNFFVNKLIVKCQIVNPYLDSSKAFDKPCHMHELWPGPLLEIKFRPANHYQNSIRHNLSLHSKFMRVQ***TGKSSWWMLN**************************************************************************************************************************************************HLVNSCNC************************************SSVLDDFNLNIESLQGFDCNVDEVY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTVEALRNGITPSPSSSVSESLDLFPEDSPIHFQLRCLKITPTQVDHFENDNFFVNKLIVKCQIVNPYLDSSKAFDKPCHMHELWPGPLLEIKFRPANHYQNSIRHNLSLHSKFMRVQNEGTGKSSWWMLNPDAKAGKSARRRATSMETSKFEKRRGRVKKKVEALRNGITPSPSSSVSEIRTTDSVPHPTLPPVGLIFSPDYRQRASSNASSCGRLSPIPAQESPAWLPPYSNPYLGAEQLAGSLETTMKLSSDNFLPYPSPPPPYGAPPPYPCPHHLVNSCNCHNHPAVKQQSISPSYHNSPSPSPPATVMGQVLSSLNSSVLDDFNLNIESLQGFDCNVDEVY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Forkhead box protein O Transcription factor involved in the regulation of the insulin signaling pathway. Consistently activates both the downstream target Thor\d4EBP and the feedback control target InR. Involved in negative regulation of the cell cycle, modulating cell growth and proliferation. In response to cellular stresses, such as nutrient deprivation or increased levels of reactive oxygen species, foxo is activated and inhibits growth through the action of target genes such as Thor. Foxo activated in the adult fat body can regulate lifespan in adults; an insulin peptide itself may function as one secondary messenger of insulin-regulated aging. Also regulates Lip4, homolog of human acid lipases, thereby acting as a key modulator of lipid metabolism by insulin signaling and integrates insulin responses to glucose and lipid homeostasis.confidentQ95V55
Forkhead box protein O Transcription factor involved in the regulation of the insulin signaling pathway. Consistently activates both the downstream target Thor\d4EBP and the feedback control target InR. Involved in negative regulation of the cell cycle, modulating cell growth and proliferation. In response to cellular stresses, such as nutrient deprivation or increased levels of reactive oxygen species, foxo is activated and inhibits growth through the action of target genes such as Thor. Foxo activated in the adult fat body can regulate lifespan in adults; an insulin peptide itself may function as one secondary messenger of insulin-regulated aging. Also regulates Lip4, homolog of human acid lipases, thereby acting as a key modulator of lipid metabolism by insulin signaling and integrates insulin responses to glucose and lipid homeostasis.confidentQ298W7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0034198 [BP]cellular response to amino acid starvationprobableGO:0009267, GO:0051716, GO:0031669, GO:0033554, GO:0009605, GO:0050896, GO:0009987, GO:0031668, GO:0031667, GO:0008150, GO:0006950, GO:0071496, GO:0044763, GO:0044699, GO:0042594, GO:0007154, GO:0009991
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0001578 [BP]microtubule bundle formationprobableGO:0006996, GO:0007017, GO:0007010, GO:0009987, GO:0016043, GO:0008150, GO:0044763, GO:0071840, GO:0000226, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0001077 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcriptionprobableGO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1E17, chain A
Confidence level:very confident
Coverage over the Query: 46-135
View the alignment between query and template
View the model in PyMOL