Diaphorina citri psyllid: psy12678


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MGGVGTPVDQQFALRWNDFQTSILSSFRHLRDEEDFVDVTLACDGCSFTAHKVVLSACSPYFKTLLKSIDGRRLCVDTAL
ccccccccccEEEEEccccHHHHHHHHHHHHccccCEEEEEECccCEEEEEEEEEEcccHHHHHHHHHccccccEEEEcc
*********QQFALRWNDFQTSILSSFRHLRDEEDFVDVTLACDGCSFTAHKVVLSACSPYFKTLLKSIDGRRLCVDTAL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGVGTPVDQQFALRWNDFQTSILSSFRHLRDEEDFVDVTLACDGCSFTAHKVVLSACSPYFKTLLKSIDGRRLCVDTAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein abrupt Expression is vital for development; may be involved in transcriptional regulation. In embryos, muscle specific expression is required for segmental nerve b (SNb) motoneuron target recognition within ventral longitudinal muscles. Has a role in establishing and maintaining embryonic muscle attachments, adult sensory cell formation (macrochaetae) and morphogenesis of adult appendages (legs, antenna aristae and male external genitalia). Has a role in the morphogenesis of the class I dendritic neurons: selective expression of ab in class I da neurons plays a pivotal role in forming dendritic arbors, which are characteristic of the class I cells. The development of more complex arbors of class II-IV neurons depends on the absence of ab.confidentQ24174

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001751 [BP]compound eye photoreceptor cell differentiationprobableGO:0032502, GO:0044707, GO:0030154, GO:0009653, GO:0007275, GO:0044699, GO:0001745, GO:0048869, GO:0048513, GO:0048749, GO:0009887, GO:0032501, GO:0030182, GO:0048592, GO:0009987, GO:0044767, GO:0001654, GO:0048731, GO:0001754, GO:0022008, GO:0048699, GO:0007399, GO:0007423, GO:0048856, GO:0044763, GO:0046530, GO:0008150
GO:0031519 [CC]PcG protein complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0048813 [BP]dendrite morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0000978 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA bindingprobableGO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001159, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0000987, GO:0003674, GO:0097159, GO:1901363, GO:0005488
GO:0016203 [BP]muscle attachmentprobableGO:0032502, GO:0007517, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0061061, GO:0048513, GO:0008150, GO:0060538, GO:0048731, GO:0007275, GO:0044699
GO:0031463 [CC]Cul3-RING ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0051704 [BP]multi-organism processprobableGO:0008150
GO:0016567 [BP]protein ubiquitinationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0016198 [BP]axon choice point recognitionprobableGO:0008037, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0008038, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0032990, GO:0048858, GO:0040011, GO:0048699, GO:0009605, GO:0044707, GO:0050896, GO:0048856, GO:0007399, GO:0032502, GO:0048812, GO:0008150
GO:0007435 [BP]salivary gland morphogenesisprobableGO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0007431, GO:0048856, GO:0044767, GO:0035272, GO:0008150, GO:0048731, GO:0022612, GO:0048732, GO:0009653, GO:0007275, GO:0044699
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0050793 [BP]regulation of developmental processprobableGO:0008150, GO:0065007, GO:0050789
GO:0007548 [BP]sex differentiationprobableGO:0032502, GO:0003006, GO:0008150, GO:0000003, GO:0022414
GO:0006342 [BP]chromatin silencingprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0040029, GO:0010629, GO:0050789, GO:0044699, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0008150, GO:0060255, GO:0016458, GO:0065007, GO:0048519, GO:0045814, GO:0010468, GO:0045934, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0044763, GO:0010558, GO:0048523
GO:0008039 [BP]synaptic target recognitionprobableGO:0048666, GO:0008037, GO:0048699, GO:0032501, GO:0030182, GO:0044707, GO:0048869, GO:0030154, GO:0048468, GO:0007399, GO:0008038, GO:0044767, GO:0044763, GO:0048731, GO:0007275, GO:0008150, GO:0009987, GO:0032502, GO:0022008, GO:0044699, GO:0048856
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0044708 [BP]single-organism behaviorprobableGO:0050896, GO:0008150, GO:0007610
GO:0007426 [BP]tracheal outgrowth, open tracheal systemprobableGO:0060541, GO:0007424, GO:0032501, GO:0035239, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0035295, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0003680 [MF]AT DNA bindingprobableGO:0043565, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0007298 [BP]border follicle cell migrationprobableGO:0048610, GO:0048870, GO:0030154, GO:0048468, GO:0019953, GO:0006928, GO:0007292, GO:0051674, GO:0007297, GO:0001667, GO:0044699, GO:0000003, GO:0048869, GO:0030707, GO:0051179, GO:0007276, GO:0016477, GO:0048477, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0090132, GO:0090130, GO:0040011, GO:0044702, GO:0010631, GO:0044707, GO:0003006, GO:0048856, GO:0044763
GO:0001078 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcriptionprobableGO:0001227, GO:0003700, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0005701 [CC]polytene chromosome chromocenterprobableGO:0005575, GO:0005622, GO:0043232, GO:0044464, GO:0005700, GO:0010369, GO:0044446, GO:0043229, GO:0043228, GO:0005623, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0000980 [MF]RNA polymerase II distal enhancer sequence-specific DNA bindingprobableGO:0005488, GO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001158, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363, GO:0035326
GO:0045165 [BP]cell fate commitmentprobableGO:0032502, GO:0030154, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0007417 [BP]central nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0007560 [BP]imaginal disc morphogenesisprobableGO:0032502, GO:0009791, GO:0048707, GO:0009886, GO:0044707, GO:0007444, GO:0048569, GO:0032501, GO:0007552, GO:0048563, GO:0044767, GO:0002165, GO:0048513, GO:0008150, GO:0009887, GO:0048731, GO:0009653, GO:0007275, GO:0044699, GO:0048856
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GA1, chain A
Confidence level:very confident
Coverage over the Query: 10-75
View the alignment between query and template
View the model in PyMOL