Diaphorina citri psyllid: psy12687


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MLLNEVKDEYMSSIKKAVVDFAIHDPREPQLSIMEKEQVPSLNPMLEMGSEFKDTFDQNKKKLDNSLFTIHPVLSEMSNIWFKNFKDWEEKLMLLQEIIDEWVKVQQTWMYLEPIFSSPDIQAQMPEEGRRFSAMDKLTCVHT
cccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHccccc
MLLNEVKDEYMSSIKKAVVDFAIHDPREPQLSIMEKEQVPSLNPMLEMGSEFKDTFDQNKKKLDNSLFTIHPVLSEMSNIWFKNFKDWEEKLMLLQEIIDEWVKVQQTWMYLEPIFSSPDIQAQMPEEGRRFSAMDKLTCVHT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLNEVKDEYMSSIKKAVVDFAIHDPREPQLSIMEKEQVPSLNPMLEMGSEFKDTFDQNKKKLDNSLFTIHPVLSEMSNIWFKNFKDWEEKLMLLQEIIDEWVKVQQTWMYLEPIFSSPDIQAQMPEEGRRFSAMDKLTCVHT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005929 [CC]ciliumprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0017111 [MF]nucleoside-triphosphatase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VKG, chain A
Confidence level:very confident
Coverage over the Query: 3-143
View the alignment between query and template
View the model in PyMOL