Diaphorina citri psyllid: psy12689


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--
MGTLSYYPWKGFPGYFFPFQNTEGYLAPVIAVHFESPAIGVLINIECKAWAHNIHHDRHERRGSVHFELMID
cccEEECcccccccccccccccccccccEEEEEEEccccccEEEEEEEEEccccccccccccCEEEEEEEEc
MGTLSYYPWKGFPGYFFPFQNTEGYLAPVIAVHFESPAIGVLINIECKAWAHNIHHDRHERRGSVHFELMID
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTLSYYPWKGFPGYFFPFQNTEGYLAPVIAVHFESPAIGVLINIECKAWAHNIHHDRHERRGSVHFELMID

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium/potassium-transporting ATPase subunit beta-2 This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane.confidentQ24048

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006812 [BP]cation transportprobableGO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0005918 [CC]septate junctionprobableGO:0005575, GO:0070160, GO:0043296, GO:0030054, GO:0005911
GO:0008324 [MF]cation transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0015075, GO:0022857, GO:0003674

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KDP, chain B
Confidence level:very confident
Coverage over the Query: 1-72
View the alignment between query and template
View the model in PyMOL