Diaphorina citri psyllid: psy12692


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------
MGNYYPRQSGELELKFDISDYICVKFLLLLNPDVRGILNRTHVEEGHEQVQKALLDYCITAYPQIQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQKFDLLSLGLLGVPTLRDRFTQVTHKLSELKFPNCDKFGKLMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHAKRK
ccccHHHHHHHHHccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEccccEEEHHHHHccccccHHHHHHHHHHHHHHccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccc
MGNYYPRQSGELELKFDISDYICVKFLLLLNPDVRGILNRTHVEEGHEQVQKALLDYCITAYPQIQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQKFDLLSLGLLGVPTLRDRFTQVTHKLSELKFPNCDKFGKLMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHA***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNYYPRQSGELELKFDISDYICVKFLLLLNPDVRGILNRTHVEEGHEQVQKALLDYCITAYPQIQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQKFDLLSLGLLGVPTLRDRFTQVTHKLSELKFPNCDKFGKLMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHAKRK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nuclear hormone receptor FTZ-F1 Acts as a cofactor to fushi tarazu (ftz). Facilitates the binding of ftz to DNA. Binds the sequence element 5'-YCYYGGYCR-3' in the zebra element of ftz. Probably also functions as a receptor for a yet unknown ligand.confidentP33244

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000976 [MF]transcription regulatory region sequence-specific DNA bindingprobableGO:0044212, GO:0043565, GO:0097159, GO:0003677, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0000975, GO:1901363
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0001077 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcriptionprobableGO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NXX, chain A
Confidence level:very confident
Coverage over the Query: 23-184
View the alignment between query and template
View the model in PyMOL
Template: 1H9U, chain A
Confidence level:probable
Coverage over the Query: 1-66
View the alignment between query and template
View the model in PyMOL