Psyllid ID: psy12692


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------
MGNYYPRQSGELELKFDISDYICVKFLLLLNPDVRGILNRTHVEEGHEQVQKALLDYCITAYPQIQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQKFDLLSLGLLGVPTLRDRFTQVTHKLSELKFPNCDKFGKLMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHAKRK
ccccHHHHHHHHHccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEccccEEEHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccc
ccccHHHHHHHcEccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccEEEEHHHHHEEEccHHHHHHHHHHHHHHcccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccc
mgnyyprqsgelelkfdiSDYICVKFLLLlnpdvrgilnrtHVEEGHEQVQKALLDYCITaypqiqvdDQMKLLQHSWSDMLVLDHMHQRmhnalpdettlhngqkfdllslgllgvptlrdRFTQVTHKlselkfpncdkfgkLMSILPELHEIASRgeehlyhkhcnggapTQTLLMEMLHAKRK
mgnyyprqsgELELKFDISDYICVKFLLLLNPDVRGILNRTHVEEGHEQVQKALLDYCITAYPQIQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQKFDLLSLGLLGVPTLRDRFTQVThklselkfpncdKFGKLMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHAKRK
MGNYYPRQSGELELKFDISDYICVKFLLLLNPDVRGILNRTHVEEGHEQVQKALLDYCITAYPQIQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQKFDllslgllgVPTLRDRFTQVTHKLSELKFPNCDKFGKLMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHAKRK
***********LELKFDISDYICVKFLLLLNPDVRGILNRTHVEEGHEQVQKALLDYCITAYPQIQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQKFDLLSLGLLGVPTLRDRFTQVTHKLSELKFPNCDKFGKLMSILPELHEIASRGEEHLYHKHCNGGA***************
MGNYYPRQSGELELKFDISDYICVKFLLLLNPDVRGILNRTHVEEGHEQVQKALLDYCITAYPQIQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQKFDLLSLGLLGVPTLRDRFTQVTHKLSELKFPNCDKFGKLMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHA***
MGNYYPRQSGELELKFDISDYICVKFLLLLNPDVRGILNRTHVEEGHEQVQKALLDYCITAYPQIQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQKFDLLSLGLLGVPTLRDRFTQVTHKLSELKFPNCDKFGKLMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHAKRK
MGNYYPRQSGELELKFDISDYICVKFLLLLNPDVRGILNRTHVEEGHEQVQKALLDYCITAYPQIQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQKFDLLSLGLLGVPTLRDRFTQVTHKLSELKFPNCDKFGKLMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHA***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNYYPRQSGELELKFDISDYICVKFLLLLNPDVRGILNRTHVEEGHEQVQKALLDYCITAYPQIQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQKFDLLSLGLLGVPTLRDRFTQVTHKLSELKFPNCDKFGKLMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHAKRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query187 2.2.26 [Sep-21-2011]
P49867534 Nuclear hormone receptor N/A N/A 0.673 0.235 0.537 1e-43
P332441027 Nuclear hormone receptor yes N/A 0.673 0.122 0.508 1e-39
O42101501 Nuclear receptor subfamil yes N/A 0.668 0.249 0.297 3e-14
O00482541 Nuclear receptor subfamil no N/A 0.668 0.231 0.291 7e-14
P45448560 Nuclear receptor subfamil no N/A 0.668 0.223 0.308 6e-13
Q9QWM1560 Nuclear receptor subfamil yes N/A 0.668 0.223 0.314 8e-13
Q95L87463 Steroidogenic factor 1 OS N/A N/A 0.684 0.276 0.307 6e-12
P33242462 Steroidogenic factor 1 OS no N/A 0.668 0.270 0.291 1e-08
P50569462 Steroidogenic factor 1 OS no N/A 0.668 0.270 0.291 2e-08
Q9GKL2461 Steroidogenic factor 1 OS no N/A 0.668 0.271 0.285 2e-08
>sp|P49867|FTZF1_BOMMO Nuclear hormone receptor FTZ-F1 OS=Bombyx mori GN=FTZ-F1 PE=1 SV=2 Back     alignment and function desciption
 Score =  176 bits (445), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 93/173 (53%), Positives = 109/173 (63%), Gaps = 47/173 (27%)

Query: 62  YPQIQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQKFDLLSLGLLGVPTLR 121
           +  ++VDDQMKLLQ SWS MLVLDH+HQRMHN LPDETTLHNGQKFDLL LGLLGVP+L 
Sbjct: 361 FKYLKVDDQMKLLQDSWSVMLVLDHLHQRMHNGLPDETTLHNGQKFDLLCLGLLGVPSLA 420

Query: 122 DRFTQVTHKLSELKFP------------------------------------------NC 139
           D F ++ +KL+ELKF                                            C
Sbjct: 421 DHFNELQNKLAELKFDVPDYICVKFMLLLNPEVRGIVNVKCVREGYQTVQAALLDYTLTC 480

Query: 140 -----DKFGKLMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHAKRK 187
                DKFGKL+ ++PE+H +A+RGEEHLY +HC G APTQTLLMEMLHAKRK
Sbjct: 481 YPTIQDKFGKLVMVVPEIHALAARGEEHLYQRHCAGQAPTQTLLMEMLHAKRK 533




May play an important role in development.
Bombyx mori (taxid: 7091)
>sp|P33244|FTZF1_DROME Nuclear hormone receptor FTZ-F1 OS=Drosophila melanogaster GN=ftz-f1 PE=1 SV=2 Back     alignment and function description
>sp|O42101|NR5A2_CHICK Nuclear receptor subfamily 5 group A member 2 OS=Gallus gallus GN=NR5A2 PE=2 SV=1 Back     alignment and function description
>sp|O00482|NR5A2_HUMAN Nuclear receptor subfamily 5 group A member 2 OS=Homo sapiens GN=NR5A2 PE=1 SV=2 Back     alignment and function description
>sp|P45448|NR5A2_MOUSE Nuclear receptor subfamily 5 group A member 2 OS=Mus musculus GN=Nr5a2 PE=1 SV=3 Back     alignment and function description
>sp|Q9QWM1|NR5A2_RAT Nuclear receptor subfamily 5 group A member 2 OS=Rattus norvegicus GN=Nr5a2 PE=2 SV=1 Back     alignment and function description
>sp|Q95L87|STF1_MACEU Steroidogenic factor 1 OS=Macropus eugenii GN=NR5A1 PE=2 SV=1 Back     alignment and function description
>sp|P33242|STF1_MOUSE Steroidogenic factor 1 OS=Mus musculus GN=Nr5a1 PE=1 SV=3 Back     alignment and function description
>sp|P50569|STF1_RAT Steroidogenic factor 1 OS=Rattus norvegicus GN=Nr5a1 PE=2 SV=1 Back     alignment and function description
>sp|Q9GKL2|STF1_HORSE Steroidogenic factor 1 OS=Equus caballus GN=NR5A1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
270004815 588 ftz transcription factor 1 [Tribolium ca 0.657 0.209 0.594 2e-46
189235773 540 PREDICTED: similar to ecdysone response 0.673 0.233 0.578 3e-46
194326123 602 nuclear receptor [Blattella germanica] 0.673 0.209 0.583 2e-45
307199034231 Nuclear hormone receptor FTZ-F1 [Harpegn 0.673 0.545 0.560 7e-45
242019865 406 Nuclear hormone receptor FTZ-F1, putativ 0.673 0.310 0.572 1e-44
307169515231 Nuclear hormone receptor FTZ-F1 [Campono 0.684 0.554 0.548 2e-44
345494868 776 PREDICTED: nuclear hormone receptor FTZ- 0.673 0.162 0.560 4e-44
315248867 552 transcription factor betaFTZ-F1 [Spodopt 0.657 0.222 0.568 4e-44
380013038 506 PREDICTED: nuclear hormone receptor FTZ- 0.673 0.249 0.549 2e-43
17979670 582 nuclear hormone receptor betaFTZ-F1 [Man 0.657 0.211 0.558 2e-43
>gi|270004815|gb|EFA01263.1| ftz transcription factor 1 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 110/170 (64%), Gaps = 47/170 (27%)

Query: 65  IQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQKFDLLSLGLLGVPTLRDRF 124
            QVDDQMKLLQHSWSDMLVLDHMHQRMHN LPDE TLHNGQKFDLLSLGLLGVP+L D F
Sbjct: 419 FQVDDQMKLLQHSWSDMLVLDHMHQRMHNNLPDEMTLHNGQKFDLLSLGLLGVPSLADHF 478

Query: 125 TQVTHKLSELKF---------------PNC------------------------------ 139
           T +T KL ELKF               P+                               
Sbjct: 479 TDITAKLQELKFDVSDYICVKFLLLLNPDVRGITNKKHVQEGYEQVQQALLEYTVTCYPQ 538

Query: 140 --DKFGKLMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHAKRK 187
             DKF K+M +LPE+H +A+RGEEHLYHKHC+G APTQTLLMEMLHAKRK
Sbjct: 539 IQDKFNKMMQLLPEIHSLATRGEEHLYHKHCSGSAPTQTLLMEMLHAKRK 588




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189235773|ref|XP_970369.2| PREDICTED: similar to ecdysone response nuclear receptor Ftz-F1 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|194326123|emb|CAQ57670.1| nuclear receptor [Blattella germanica] Back     alignment and taxonomy information
>gi|307199034|gb|EFN79758.1| Nuclear hormone receptor FTZ-F1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242019865|ref|XP_002430379.1| Nuclear hormone receptor FTZ-F1, putative [Pediculus humanus corporis] gi|212515503|gb|EEB17641.1| Nuclear hormone receptor FTZ-F1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307169515|gb|EFN62157.1| Nuclear hormone receptor FTZ-F1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345494868|ref|XP_001600363.2| PREDICTED: nuclear hormone receptor FTZ-F1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|315248867|gb|ADT91626.1| transcription factor betaFTZ-F1 [Spodoptera litura] Back     alignment and taxonomy information
>gi|380013038|ref|XP_003690577.1| PREDICTED: nuclear hormone receptor FTZ-F1-like [Apis florea] Back     alignment and taxonomy information
>gi|17979670|gb|AAL50351.1| nuclear hormone receptor betaFTZ-F1 [Manduca sexta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
UNIPROTKB|I3LCV8167 NR5A2 "Uncharacterized protein 0.251 0.281 0.553 1.1e-20
UNIPROTKB|F1NVB5501 NR5A2 "Nuclear receptor subfam 0.251 0.093 0.574 2.9e-20
ZFIN|ZDB-GENE-990415-79517 nr5a2 "nuclear receptor subfam 0.251 0.090 0.574 8.3e-20
UNIPROTKB|O42101501 NR5A2 "Nuclear receptor subfam 0.251 0.093 0.574 9.9e-20
FB|FBgn00010781027 ftz-f1 "ftz transcription fact 0.508 0.092 0.504 1.3e-19
UNIPROTKB|B4E2P3469 NR5A2 "cDNA FLJ52395, highly s 0.251 0.100 0.553 2.7e-19
UNIPROTKB|F1PXN4519 NR5A2 "Uncharacterized protein 0.251 0.090 0.553 3.7e-19
UNIPROTKB|O00482541 NR5A2 "Nuclear receptor subfam 0.251 0.086 0.553 4.2e-19
MGI|MGI:1346834560 Nr5a2 "nuclear receptor subfam 0.251 0.083 0.531 6e-19
UNIPROTKB|F1MCM4541 NR5A2 "Uncharacterized protein 0.251 0.086 0.531 6.9e-19
UNIPROTKB|I3LCV8 NR5A2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 141 (54.7 bits), Expect = 1.1e-20, Sum P(2) = 1.1e-20
 Identities = 26/47 (55%), Positives = 35/47 (74%)

Query:   140 DKFGKLMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHAKR 186
             +KFG+L+  LPE+  I+ + EE+LY+KH NG  P   LL+EMLHAKR
Sbjct:   120 EKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR 166


GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA
GO:0045070 "positive regulation of viral genome replication" evidence=IEA
GO:0044212 "transcription regulatory region DNA binding" evidence=IEA
GO:0042632 "cholesterol homeostasis" evidence=IEA
GO:0042127 "regulation of cell proliferation" evidence=IEA
GO:0008206 "bile acid metabolic process" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0005543 "phospholipid binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0003707 "steroid hormone receptor activity" evidence=IEA
UNIPROTKB|F1NVB5 NR5A2 "Nuclear receptor subfamily 5 group A member 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-79 nr5a2 "nuclear receptor subfamily 5, group A, member 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O42101 NR5A2 "Nuclear receptor subfamily 5 group A member 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0001078 ftz-f1 "ftz transcription factor 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B4E2P3 NR5A2 "cDNA FLJ52395, highly similar to Orphan nuclear receptor NR5A2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PXN4 NR5A2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O00482 NR5A2 "Nuclear receptor subfamily 5 group A member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1346834 Nr5a2 "nuclear receptor subfamily 5, group A, member 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MCM4 NR5A2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P33244FTZF1_DROMENo assigned EC number0.50860.67370.1226yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
cd06944237 cd06944, NR_LBD_Ftz-F1_like, The ligand binding do 4e-52
cd06944237 cd06944, NR_LBD_Ftz-F1_like, The ligand binding do 2e-20
cd07069241 cd07069, NR_LBD_Lrh-1, The ligand binding domain o 2e-17
cd07070237 cd07070, NR_LBD_SF-1, The ligand binding domain of 9e-15
cd06930165 cd06930, NR_LBD_F2, Ligand-binding domain of nucle 3e-11
cd06930165 cd06930, NR_LBD_F2, Ligand-binding domain of nucle 6e-11
cd07069241 cd07069, NR_LBD_Lrh-1, The ligand binding domain o 2e-08
cd06943207 cd06943, NR_LBD_RXR_like, The ligand binding domai 4e-07
cd06948236 cd06948, NR_LBD_COUP-TF, Ligand binding domain of 7e-07
cd06157168 cd06157, NR_LBD, The ligand binding domain of nucl 9e-07
smart00430163 smart00430, HOLI, Ligand binding domain of hormone 9e-07
cd07070237 cd07070, NR_LBD_SF-1, The ligand binding domain of 7e-05
smart00430163 smart00430, HOLI, Ligand binding domain of hormone 0.002
cd06931222 cd06931, NR_LBD_HNF4_like, The ligand binding doma 0.004
>gnl|CDD|132742 cd06944, NR_LBD_Ftz-F1_like, The ligand binding domain of FTZ-F1 like nuclear receptors Back     alignment and domain information
 Score =  166 bits (422), Expect = 4e-52
 Identities = 61/172 (35%), Positives = 89/172 (51%), Gaps = 50/172 (29%)

Query: 64  QIQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQKFDLLSLGL---LGVPTL 120
           +++VDDQMKLLQ+ WS++LVLDH+++++H+   D   L  GQ+ DL +L     LG+ +L
Sbjct: 66  ELKVDDQMKLLQNCWSELLVLDHIYRQVHHGKEDSILLVTGQEVDLSTLASQAGLGLSSL 125

Query: 121 RDRFTQVTHKLSELKF-------------------------------------------- 136
            DR  ++ +KL EL+F                                            
Sbjct: 126 VDRAQELVNKLRELQFDRQEFVCLKFLILFNPDVKGLENRQLVESVQEQVNAALLDYTLC 185

Query: 137 --PNC-DKFGKLMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHAK 185
             P   DKFG+L+  LPE+  I+ + EE+LY+KH NG  P   LL+EMLHAK
Sbjct: 186 NYPQQTDKFGQLLLRLPEIRAISMQAEEYLYYKHLNGEVPCNNLLIEMLHAK 237


The ligand binding domain of FTZ-F1 like nuclear receptors: This nuclear receptor family includes at least three subgroups of receptors that function in embryo development and differentiation, and other processes. FTZ-F1 interacts with the cis-acting DNA motif of ftz gene, which required at several stages of development. Particularly, FTZ-F1 genes are strongly linked to steroid biosynthesis and sex-determination; LRH-1 is a regulator of bile-acid homeostasis, steroidogenesis, reverse cholesterol transport and the initial stages of embryonic development. SF-1 is an essential regulator of endocrine development and function and is considered a master regulator of reproduction; SF-1 functions cooperatively with other transcription factors to modulate gene expression. Phospholipids have been identified as potential ligand for LRH-1 and steroidogenic factor-1 (SF-1). However, the ligand for FTZ-F1 has not yet been identified. Most nuclear receptors function as homodimer or heterodimers. However, LRH-1 and SF-1 bind to DNA as a monomer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, receptors in this family have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). Length = 237

>gnl|CDD|132742 cd06944, NR_LBD_Ftz-F1_like, The ligand binding domain of FTZ-F1 like nuclear receptors Back     alignment and domain information
>gnl|CDD|132754 cd07069, NR_LBD_Lrh-1, The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, Back     alignment and domain information
>gnl|CDD|132755 cd07070, NR_LBD_SF-1, The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132728 cd06930, NR_LBD_F2, Ligand-binding domain of nuclear receptor family 2 Back     alignment and domain information
>gnl|CDD|132728 cd06930, NR_LBD_F2, Ligand-binding domain of nuclear receptor family 2 Back     alignment and domain information
>gnl|CDD|132754 cd07069, NR_LBD_Lrh-1, The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, Back     alignment and domain information
>gnl|CDD|132741 cd06943, NR_LBD_RXR_like, The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132746 cd06948, NR_LBD_COUP-TF, Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family Back     alignment and domain information
>gnl|CDD|132726 cd06157, NR_LBD, The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators Back     alignment and domain information
>gnl|CDD|214658 smart00430, HOLI, Ligand binding domain of hormone receptors Back     alignment and domain information
>gnl|CDD|132755 cd07070, NR_LBD_SF-1, The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|214658 smart00430, HOLI, Ligand binding domain of hormone receptors Back     alignment and domain information
>gnl|CDD|132729 cd06931, NR_LBD_HNF4_like, The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 187
cd07069241 NR_LBD_Lrh-1 The ligand binding domain of the live 99.96
cd06937231 NR_LBD_RAR The ligand binding domain (LBD) of reti 99.96
cd07348238 NR_LBD_NGFI-B The ligand binding domain of Nurr1, 99.96
cd07072239 NR_LBD_DHR38_like Ligand binding domain of DHR38_l 99.95
cd07071238 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a 99.95
cd07070237 NR_LBD_SF-1 The ligand binding domain of nuclear r 99.95
cd07076247 NR_LBD_GR Ligand binding domain of the glucocortic 99.95
cd06944237 NR_LBD_Ftz-F1_like The ligand binding domain of FT 99.95
cd06945239 NR_LBD_Nurr1_like The ligand binding domain of Nur 99.95
cd07349222 NR_LBD_SHP The ligand binding domain of DAX1 prote 99.95
cd06949235 NR_LBD_ER Ligand binding domain of Estrogen recept 99.94
cd07073246 NR_LBD_AR Ligand binding domain of the nuclear rec 99.93
cd06935243 NR_LBD_TR The ligand binding domain of thyroid hor 99.93
cd06947246 NR_LBD_GR_Like Ligand binding domain of nuclear ho 99.93
cd07350232 NR_LBD_Dax1 The ligand binding domain of DAX1 prot 99.93
cd06951222 NR_LBD_Dax1_like The ligand binding domain of DAX1 99.93
cd07075248 NR_LBD_MR Ligand binding domain of the mineralocor 99.92
cd06948236 NR_LBD_COUP-TF Ligand binding domain of chicken ov 99.92
cd06946221 NR_LBD_ERR The ligand binding domain of estrogen r 99.91
cd06941195 NR_LBD_DmE78_like The ligand binding domain of Dro 99.91
cd07068221 NR_LBD_ER_like The ligand binding domain of estrog 99.91
KOG4218|consensus475 99.9
cd06940189 NR_LBD_REV_ERB The ligand binding domain of REV-ER 99.89
cd06939241 NR_LBD_ROR_like The ligand binding domain of Retin 99.88
cd06938231 NR_LBD_EcR The ligand binding domain (LBD) of the 99.88
cd06954236 NR_LBD_LXR The ligand binding domain of Liver X re 99.88
cd06950206 NR_LBD_Tlx_PNR_like The ligand binding domain of T 99.88
cd06932259 NR_LBD_PPAR The ligand binding domain of peroxisom 99.87
cd06933238 NR_LBD_VDR The ligand binding domain of vitamin D 99.86
cd06934226 NR_LBD_PXR_like The ligand binding domain of xenob 99.85
cd06952222 NR_LBD_TR2_like The ligand binding domain of the o 99.85
cd06943207 NR_LBD_RXR_like The ligand binding domain of the r 99.83
KOG4215|consensus432 99.82
cd06931222 NR_LBD_HNF4_like The ligand binding domain of hept 99.81
cd06936221 NR_LBD_Fxr The ligand binding domain of Farnesoid 99.8
cd07074248 NR_LBD_PR Ligand binding domain of the progesteron 99.79
cd06929174 NR_LBD_F1 Ligand-binding domain of nuclear recepto 99.74
cd06953213 NR_LBD_DHR4_like The ligand binding domain of orph 99.71
cd06930165 NR_LBD_F2 Ligand-binding domain of nuclear recepto 99.69
cd06942191 NR_LBD_Sex_1_like The ligand binding domain of Cae 99.67
KOG4217|consensus605 99.6
PF00104203 Hormone_recep: Ligand-binding domain of nuclear ho 99.35
cd06936221 NR_LBD_Fxr The ligand binding domain of Farnesoid 99.35
cd07074248 NR_LBD_PR Ligand binding domain of the progesteron 99.33
cd06937231 NR_LBD_RAR The ligand binding domain (LBD) of reti 99.26
cd06951222 NR_LBD_Dax1_like The ligand binding domain of DAX1 99.25
cd06940189 NR_LBD_REV_ERB The ligand binding domain of REV-ER 99.24
cd07350232 NR_LBD_Dax1 The ligand binding domain of DAX1 prot 99.23
cd07069241 NR_LBD_Lrh-1 The ligand binding domain of the live 99.23
cd07349222 NR_LBD_SHP The ligand binding domain of DAX1 prote 99.23
cd06932259 NR_LBD_PPAR The ligand binding domain of peroxisom 99.22
cd06935243 NR_LBD_TR The ligand binding domain of thyroid hor 99.21
cd06934226 NR_LBD_PXR_like The ligand binding domain of xenob 99.19
cd06933238 NR_LBD_VDR The ligand binding domain of vitamin D 99.18
cd06157168 NR_LBD The ligand binding domain of nuclear recept 99.17
cd07076247 NR_LBD_GR Ligand binding domain of the glucocortic 99.17
cd07070237 NR_LBD_SF-1 The ligand binding domain of nuclear r 99.16
cd06950206 NR_LBD_Tlx_PNR_like The ligand binding domain of T 99.16
cd06953213 NR_LBD_DHR4_like The ligand binding domain of orph 99.13
cd06939241 NR_LBD_ROR_like The ligand binding domain of Retin 99.12
cd06944237 NR_LBD_Ftz-F1_like The ligand binding domain of FT 99.12
cd06941195 NR_LBD_DmE78_like The ligand binding domain of Dro 99.11
cd06954236 NR_LBD_LXR The ligand binding domain of Liver X re 99.1
cd06949235 NR_LBD_ER Ligand binding domain of Estrogen recept 99.09
cd07075248 NR_LBD_MR Ligand binding domain of the mineralocor 99.08
cd07073246 NR_LBD_AR Ligand binding domain of the nuclear rec 99.07
cd06947246 NR_LBD_GR_Like Ligand binding domain of nuclear ho 99.07
cd07348238 NR_LBD_NGFI-B The ligand binding domain of Nurr1, 99.06
cd06945239 NR_LBD_Nurr1_like The ligand binding domain of Nur 99.03
cd06943207 NR_LBD_RXR_like The ligand binding domain of the r 99.01
cd07071238 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a 99.01
cd06929174 NR_LBD_F1 Ligand-binding domain of nuclear recepto 99.0
cd06948236 NR_LBD_COUP-TF Ligand binding domain of chicken ov 98.97
cd06942191 NR_LBD_Sex_1_like The ligand binding domain of Cae 98.97
cd07068221 NR_LBD_ER_like The ligand binding domain of estrog 98.95
cd06946221 NR_LBD_ERR The ligand binding domain of estrogen r 98.93
cd07072239 NR_LBD_DHR38_like Ligand binding domain of DHR38_l 98.92
smart00430163 HOLI Ligand binding domain of hormone receptors. 98.91
cd06952222 NR_LBD_TR2_like The ligand binding domain of the o 98.91
cd06930165 NR_LBD_F2 Ligand-binding domain of nuclear recepto 98.89
smart00430163 HOLI Ligand binding domain of hormone receptors. 98.85
cd06938231 NR_LBD_EcR The ligand binding domain (LBD) of the 98.68
cd06931222 NR_LBD_HNF4_like The ligand binding domain of hept 98.65
KOG4215|consensus432 98.55
KOG4216|consensus479 98.52
cd06157168 NR_LBD The ligand binding domain of nuclear recept 98.29
PF00104203 Hormone_recep: Ligand-binding domain of nuclear ho 97.93
KOG4216|consensus479 97.27
KOG4218|consensus475 96.57
KOG4217|consensus605 96.02
>cd07069 NR_LBD_Lrh-1 The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, Back     alignment and domain information
Probab=99.96  E-value=1.2e-28  Score=197.87  Aligned_cols=151  Identities=34%  Similarity=0.549  Sum_probs=137.4

Q ss_pred             CCCHHHHHHhHHHHHHhHhhhh--hhcCCCcchhHHHHHHHHhhHHHHHHHHHHHHhhcCCCCcEEeeCCcccchhhh--
Q psy12692         37 ILNRTHVEEGHEQVQKALLDYC--ITAYPQIQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQKFDLLSL--  112 (187)
Q Consensus        37 l~~~~~V~~l~~~~l~~Lv~~~--~~~f~~l~~~DQ~~LL~~~w~el~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~--  112 (187)
                      ....+.+++++++.++.+++|+  +|.|.+++.+||++||++||.|++++++++++.++...+.+++++|..++....  
T Consensus        39 ~~~~~~i~~~a~~~L~~~VeWAK~iP~F~~L~~~DQi~LLk~~w~EllvL~~a~~s~~~~~~~~~ll~~~~~~~~~~~~~  118 (241)
T cd07069          39 LSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIAS  118 (241)
T ss_pred             cchHHHHHHHHHHHHHHHHHHHhhCCCcccCCHHHHHHHHHHHHHHHHHHHHHHHhhccCCCCeeEecCCCccCchhhhh
Confidence            4556899999999999999999  999999999999999999999999999999999875567888999987776542  


Q ss_pred             -hhcChHHHHHHHHHHHHHHhccCCCc-----------------------------------------------cchHHH
Q psy12692        113 -GLLGVPTLRDRFTQVTHKLSELKFPN-----------------------------------------------CDKFGK  144 (187)
Q Consensus       113 -~~~~~~~~~~~l~~~~~~l~~L~ld~-----------------------------------------------~~r~~~  144 (187)
                       ...++.++++.+++++.+|++|++|.                                               +.||++
T Consensus       119 ~~~~~~~~~~~~~~e~~~~lr~L~ld~~E~a~LKaivLfnpd~~gL~~~~~Ve~lQe~~~~aL~~yi~~~~p~~~~Rf~k  198 (241)
T cd07069         119 QAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQ  198 (241)
T ss_pred             hhhhHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHcCCCCCCCCCHHHHHHHHHHHHHHHHHHHHhcCCCchhHHHH
Confidence             23456678889999999999999999                                               899999


Q ss_pred             HHHhChhhHhhhHHHHHHHHHHhhcCCCChhhHHHHHHhcCCC
Q psy12692        145 LMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHAKRK  187 (187)
Q Consensus       145 Lll~lp~lr~ls~~~~e~l~~~~~~g~~~~~~ll~eml~~~~~  187 (187)
                      ||+++|++|+++.+++|++||+++.|.+|+++|+.||+.++++
T Consensus       199 LLl~Lp~LR~is~~~~e~l~~~~l~g~~~~~~Ll~Eml~~~~~  241 (241)
T cd07069         199 LLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA  241 (241)
T ss_pred             HHHHhHHHHHhhHHHHHHHHhccccCCCcHHHHHHHHHhcccC
Confidence            9999999999999999999999999999999999999999985



The ligand binding domain (LBD) of the liver receptor homolog-1 (LRH-1): LRH-1 belongs to nuclear hormone receptor superfamily, and is expressed mainly in the liver, intestine, exocrine pancreas, and ovary. Most nuclear receptors function as homodimer or heterodimers. However, LRH-1 binds DNA as a monomer, and is a regulator of bile-acid homeostasis, steroidogenesis, reverse cholesterol transport and the initial stages of embryonic development. Recently, phospholipids have been identified as potential ligand for LRH-1 and steroidogenic factor-1 (SF-1). Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, LRH-1 has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).

>cd06937 NR_LBD_RAR The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily Back     alignment and domain information
>cd07348 NR_LBD_NGFI-B The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors Back     alignment and domain information
>cd07072 NR_LBD_DHR38_like Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily Back     alignment and domain information
>cd07071 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors Back     alignment and domain information
>cd07070 NR_LBD_SF-1 The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily Back     alignment and domain information
>cd07076 NR_LBD_GR Ligand binding domain of the glucocorticoid receptor, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06944 NR_LBD_Ftz-F1_like The ligand binding domain of FTZ-F1 like nuclear receptors Back     alignment and domain information
>cd06945 NR_LBD_Nurr1_like The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily Back     alignment and domain information
>cd07349 NR_LBD_SHP The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>cd06949 NR_LBD_ER Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen) Back     alignment and domain information
>cd07073 NR_LBD_AR Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator Back     alignment and domain information
>cd06935 NR_LBD_TR The ligand binding domain of thyroid hormone receptor, a members of a superfamily of nuclear receptors Back     alignment and domain information
>cd06947 NR_LBD_GR_Like Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor Back     alignment and domain information
>cd07350 NR_LBD_Dax1 The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>cd06951 NR_LBD_Dax1_like The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>cd07075 NR_LBD_MR Ligand binding domain of the mineralocorticoid receptor, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06948 NR_LBD_COUP-TF Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family Back     alignment and domain information
>cd06946 NR_LBD_ERR The ligand binding domain of estrogen receptor-related nuclear receptors Back     alignment and domain information
>cd06941 NR_LBD_DmE78_like The ligand binding domain of Drosophila ecdysone-induced protein 78, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd07068 NR_LBD_ER_like The ligand binding domain of estrogen receptor and estrogen receptor-related receptors Back     alignment and domain information
>KOG4218|consensus Back     alignment and domain information
>cd06940 NR_LBD_REV_ERB The ligand binding domain of REV-ERB receptors, members of the nuclear receptor superfamily Back     alignment and domain information
>cd06939 NR_LBD_ROR_like The ligand binding domain of Retinoid-related orphan receptors, of the nuclear receptor superfamily Back     alignment and domain information
>cd06938 NR_LBD_EcR The ligand binding domain (LBD) of the Ecdysone receptor, a member of the nuclear receptors super family Back     alignment and domain information
>cd06954 NR_LBD_LXR The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors Back     alignment and domain information
>cd06950 NR_LBD_Tlx_PNR_like The ligand binding domain of Tailless-like proteins, orphan nuclear receptors Back     alignment and domain information
>cd06932 NR_LBD_PPAR The ligand binding domain of peroxisome proliferator-activated receptors Back     alignment and domain information
>cd06933 NR_LBD_VDR The ligand binding domain of vitamin D receptors, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06934 NR_LBD_PXR_like The ligand binding domain of xenobiotic receptors:pregnane X receptor and constitutive androstane receptor Back     alignment and domain information
>cd06952 NR_LBD_TR2_like The ligand binding domain of the orphan nuclear receptors TR4 and TR2 Back     alignment and domain information
>cd06943 NR_LBD_RXR_like The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily Back     alignment and domain information
>KOG4215|consensus Back     alignment and domain information
>cd06931 NR_LBD_HNF4_like The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes Back     alignment and domain information
>cd06936 NR_LBD_Fxr The ligand binding domain of Farnesoid X receptor:a member of the nuclear receptor superfamily of ligand-activated transcription factors Back     alignment and domain information
>cd07074 NR_LBD_PR Ligand binding domain of the progesterone receptor, a member of the nuclear hormone receptor Back     alignment and domain information
>cd06929 NR_LBD_F1 Ligand-binding domain of nuclear receptor family 1 Back     alignment and domain information
>cd06953 NR_LBD_DHR4_like The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4 Back     alignment and domain information
>cd06930 NR_LBD_F2 Ligand-binding domain of nuclear receptor family 2 Back     alignment and domain information
>cd06942 NR_LBD_Sex_1_like The ligand binding domain of Caenorhabditis elegans nuclear hormone receptor Sex-1 protein Back     alignment and domain information
>KOG4217|consensus Back     alignment and domain information
>PF00104 Hormone_recep: Ligand-binding domain of nuclear hormone receptor; InterPro: IPR000536 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis Back     alignment and domain information
>cd06936 NR_LBD_Fxr The ligand binding domain of Farnesoid X receptor:a member of the nuclear receptor superfamily of ligand-activated transcription factors Back     alignment and domain information
>cd07074 NR_LBD_PR Ligand binding domain of the progesterone receptor, a member of the nuclear hormone receptor Back     alignment and domain information
>cd06937 NR_LBD_RAR The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily Back     alignment and domain information
>cd06951 NR_LBD_Dax1_like The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>cd06940 NR_LBD_REV_ERB The ligand binding domain of REV-ERB receptors, members of the nuclear receptor superfamily Back     alignment and domain information
>cd07350 NR_LBD_Dax1 The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>cd07069 NR_LBD_Lrh-1 The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, Back     alignment and domain information
>cd07349 NR_LBD_SHP The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>cd06932 NR_LBD_PPAR The ligand binding domain of peroxisome proliferator-activated receptors Back     alignment and domain information
>cd06935 NR_LBD_TR The ligand binding domain of thyroid hormone receptor, a members of a superfamily of nuclear receptors Back     alignment and domain information
>cd06934 NR_LBD_PXR_like The ligand binding domain of xenobiotic receptors:pregnane X receptor and constitutive androstane receptor Back     alignment and domain information
>cd06933 NR_LBD_VDR The ligand binding domain of vitamin D receptors, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06157 NR_LBD The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators Back     alignment and domain information
>cd07076 NR_LBD_GR Ligand binding domain of the glucocorticoid receptor, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd07070 NR_LBD_SF-1 The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily Back     alignment and domain information
>cd06950 NR_LBD_Tlx_PNR_like The ligand binding domain of Tailless-like proteins, orphan nuclear receptors Back     alignment and domain information
>cd06953 NR_LBD_DHR4_like The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4 Back     alignment and domain information
>cd06939 NR_LBD_ROR_like The ligand binding domain of Retinoid-related orphan receptors, of the nuclear receptor superfamily Back     alignment and domain information
>cd06944 NR_LBD_Ftz-F1_like The ligand binding domain of FTZ-F1 like nuclear receptors Back     alignment and domain information
>cd06941 NR_LBD_DmE78_like The ligand binding domain of Drosophila ecdysone-induced protein 78, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06954 NR_LBD_LXR The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors Back     alignment and domain information
>cd06949 NR_LBD_ER Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen) Back     alignment and domain information
>cd07075 NR_LBD_MR Ligand binding domain of the mineralocorticoid receptor, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd07073 NR_LBD_AR Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator Back     alignment and domain information
>cd06947 NR_LBD_GR_Like Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor Back     alignment and domain information
>cd07348 NR_LBD_NGFI-B The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors Back     alignment and domain information
>cd06945 NR_LBD_Nurr1_like The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily Back     alignment and domain information
>cd06943 NR_LBD_RXR_like The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily Back     alignment and domain information
>cd07071 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors Back     alignment and domain information
>cd06929 NR_LBD_F1 Ligand-binding domain of nuclear receptor family 1 Back     alignment and domain information
>cd06948 NR_LBD_COUP-TF Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family Back     alignment and domain information
>cd06942 NR_LBD_Sex_1_like The ligand binding domain of Caenorhabditis elegans nuclear hormone receptor Sex-1 protein Back     alignment and domain information
>cd07068 NR_LBD_ER_like The ligand binding domain of estrogen receptor and estrogen receptor-related receptors Back     alignment and domain information
>cd06946 NR_LBD_ERR The ligand binding domain of estrogen receptor-related nuclear receptors Back     alignment and domain information
>cd07072 NR_LBD_DHR38_like Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily Back     alignment and domain information
>smart00430 HOLI Ligand binding domain of hormone receptors Back     alignment and domain information
>cd06952 NR_LBD_TR2_like The ligand binding domain of the orphan nuclear receptors TR4 and TR2 Back     alignment and domain information
>cd06930 NR_LBD_F2 Ligand-binding domain of nuclear receptor family 2 Back     alignment and domain information
>smart00430 HOLI Ligand binding domain of hormone receptors Back     alignment and domain information
>cd06938 NR_LBD_EcR The ligand binding domain (LBD) of the Ecdysone receptor, a member of the nuclear receptors super family Back     alignment and domain information
>cd06931 NR_LBD_HNF4_like The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes Back     alignment and domain information
>KOG4215|consensus Back     alignment and domain information
>KOG4216|consensus Back     alignment and domain information
>cd06157 NR_LBD The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators Back     alignment and domain information
>PF00104 Hormone_recep: Ligand-binding domain of nuclear hormone receptor; InterPro: IPR000536 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis Back     alignment and domain information
>KOG4216|consensus Back     alignment and domain information
>KOG4218|consensus Back     alignment and domain information
>KOG4217|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
2xhs_A245 Crystal Structure Of The Ligand Binding Domain Of F 2e-32
1yuc_A255 Human Nuclear Receptor Liver Receptor Homologue-1, 5e-16
1yok_A256 Crystal Structure Of Human Lrh-1 Bound With Tif-2 P 5e-16
1zdu_A245 The Crystal Structure Of Human Liver Receptor Homol 5e-16
3plz_A257 Human Lrh1 Lbd Bound To Gr470 Length = 257 5e-16
3tx7_B352 Crystal Structure Of Lrh-1BETA-Catenin Complex Leng 2e-15
4dos_A242 Human Nuclear Receptor Liver Receptor Homologue-1, 8e-15
1pk5_A248 Crystal Structure Of The Orphan Nuclear Receptor Lr 5e-13
1zh7_A243 Structural And Biochemical Basis For Selective Repr 8e-13
3f7d_A244 Sf-1 Lbd Bound By Phosphatidylcholine Length = 244 4e-08
1ymt_A246 Mouse Sf-1 Lbd Length = 246 4e-08
1yp0_A239 Structure Of The Steroidogenic Factor-1 Ligand Bind 1e-07
1yow_A242 Human Steroidogenic Factor 1 Lbd With Bound Co-Fact 1e-05
1g2n_A264 Crystal Structure Of The Ligand Binding Domain Of T 2e-05
2nxx_A235 Crystal Structure Of The Ligand-Binding Domains Of 2e-05
2nxx_A235 Crystal Structure Of The Ligand-Binding Domains Of 8e-04
1r1k_A263 Crystal Structure Of The Ligand-Binding Domains Of 3e-05
1zdt_A241 The Crystal Structure Of Human Steroidogenic Factor 9e-05
1uhl_A236 Crystal Structure Of The Lxralfa-Rxrbeta Lbd Hetero 9e-05
1h9u_A224 The Structure Of The Human Retinoid-X-Receptor Beta 1e-04
3eyb_A219 Structural And Functional Insights Into The Ligand 1e-04
3dzu_A467 Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp 4e-04
1lbd_A282 Ligand-Binding Domain Of The Human Nuclear Receptor 4e-04
1z5x_U262 Hemipteran Ecdysone Receptor Ligand-Binding Domain 5e-04
3uvv_B244 Crystal Structure Of The Ligand Binding Domains Of 6e-04
3e94_A244 Crystal Structure Of Rxralpha Ligand Binding Domain 6e-04
1rdt_A242 Crystal Structure Of A New Rexinoid Bound To The Rx 6e-04
3a9e_A240 Crystal Structure Of A Mixed Agonist-Bound Rar-Alph 6e-04
1mv9_A240 Crystal Structure Of The Human Rxr Alpha Ligand Bin 6e-04
1fby_A239 Crystal Structure Of The Human Rxr Alpha Ligand Bin 6e-04
1xdk_A238 Crystal Structure Of The RarbetaRXRALPHA LIGAND BIN 6e-04
1fm6_A238 The 2.1 Angstrom Resolution Crystal Structure Of Th 6e-04
1xv9_A236 Crystal Structure Of CarRXR HETERODIMER BOUND WITH 6e-04
1dkf_A233 Crystal Structure Of A Heterodimeric Complex Of Rar 7e-04
3pcu_A230 Crystal Structure Of Human Retinoic X Receptor Alph 7e-04
3oap_A231 Crystal Structure Of Human Retinoid X Receptor Alph 7e-04
1xls_A232 Crystal Structure Of The Mouse CarRXR LBD HETERODIM 7e-04
3h0a_A228 Crystal Structure Of Peroxisome Proliferator-Activa 7e-04
2gl8_A241 Human Retinoic Acid Receptor Rxr-Gamma Ligand-Bindi 8e-04
>pdb|2XHS|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Fushi Tarazu Factor 1 Of Drosophila Melanogaster Length = 245 Back     alignment and structure

Iteration: 1

Score = 135 bits (339), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 78/173 (45%), Positives = 94/173 (54%), Gaps = 47/173 (27%) Query: 62 YPQIQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQKFDXXXXXXXXVPTLR 121 + ++VDDQ KLLQHSWSD LVLDH+H R+HN LPDET L+NGQ F+ VP L Sbjct: 72 FKDLKVDDQXKLLQHSWSDXLVLDHLHHRIHNGLPDETQLNNGQVFNLXSLGLLGVPQLG 131 Query: 122 DRFTQVTHKLSELKF---------------PNC--------------------------- 139 D F ++ +KL +LKF P+ Sbjct: 132 DYFNELQNKLQDLKFDXGDYVCXKFLILLNPSVRGIVNRKTVSEGHDNVQAALLDYTLTC 191 Query: 140 -----DKFGKLMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHAKRK 187 DKF L++ILPE+H A RGE+HLY KHC G APTQTLL E LHAKRK Sbjct: 192 YPSVNDKFRGLVNILPEIHAXAVRGEDHLYTKHCAGSAPTQTLLXEXLHAKRK 244
>pdb|1YUC|A Chain A, Human Nuclear Receptor Liver Receptor Homologue-1, Lrh-1, Bound To Phospholipid And A Fragment Of Human Shp Length = 255 Back     alignment and structure
>pdb|1YOK|A Chain A, Crystal Structure Of Human Lrh-1 Bound With Tif-2 Peptide And Phosphatidylglycerol Length = 256 Back     alignment and structure
>pdb|1ZDU|A Chain A, The Crystal Structure Of Human Liver Receptor Homologue-1 Length = 245 Back     alignment and structure
>pdb|3PLZ|A Chain A, Human Lrh1 Lbd Bound To Gr470 Length = 257 Back     alignment and structure
>pdb|3TX7|B Chain B, Crystal Structure Of Lrh-1BETA-Catenin Complex Length = 352 Back     alignment and structure
>pdb|4DOS|A Chain A, Human Nuclear Receptor Liver Receptor Homologue-1, Lrh-1, Bound To Dlpc And A Fragment Of Tif-2 Length = 242 Back     alignment and structure
>pdb|1PK5|A Chain A, Crystal Structure Of The Orphan Nuclear Receptor Lrh-1 Length = 248 Back     alignment and structure
>pdb|1ZH7|A Chain A, Structural And Biochemical Basis For Selective Repression Of The Orphan Nuclear Receptor Lrh-1 By Shp Length = 243 Back     alignment and structure
>pdb|3F7D|A Chain A, Sf-1 Lbd Bound By Phosphatidylcholine Length = 244 Back     alignment and structure
>pdb|1YMT|A Chain A, Mouse Sf-1 Lbd Length = 246 Back     alignment and structure
>pdb|1YP0|A Chain A, Structure Of The Steroidogenic Factor-1 Ligand Binding Domain Bound To Phospholipid And A Shp Peptide Motif Length = 239 Back     alignment and structure
>pdb|1YOW|A Chain A, Human Steroidogenic Factor 1 Lbd With Bound Co-Factor Peptide Length = 242 Back     alignment and structure
>pdb|1G2N|A Chain A, Crystal Structure Of The Ligand Binding Domain Of The Ultraspiracle Protein Usp, The Ortholog Of Rxrs In Insects Length = 264 Back     alignment and structure
>pdb|2NXX|A Chain A, Crystal Structure Of The Ligand-Binding Domains Of The T.Castaneum (Coleoptera) Heterodimer Ecrusp Bound To Ponasterone A Length = 235 Back     alignment and structure
>pdb|2NXX|A Chain A, Crystal Structure Of The Ligand-Binding Domains Of The T.Castaneum (Coleoptera) Heterodimer Ecrusp Bound To Ponasterone A Length = 235 Back     alignment and structure
>pdb|1R1K|A Chain A, Crystal Structure Of The Ligand-Binding Domains Of The Heterodimer EcrUSP BOUND TO PONASTERONE A Length = 263 Back     alignment and structure
>pdb|1ZDT|A Chain A, The Crystal Structure Of Human Steroidogenic Factor-1 Length = 241 Back     alignment and structure
>pdb|1UHL|A Chain A, Crystal Structure Of The Lxralfa-Rxrbeta Lbd Heterodimer Length = 236 Back     alignment and structure
>pdb|1H9U|A Chain A, The Structure Of The Human Retinoid-X-Receptor Beta Ligand Binding Domain In Complex With The Specific Synthetic Agonist Lg100268 Length = 224 Back     alignment and structure
>pdb|3EYB|A Chain A, Structural And Functional Insights Into The Ligand Binding Domain Of A Non-Duplicated Rxr From The Invertebrate Chordate Amphioxus Length = 219 Back     alignment and structure
>pdb|3DZU|A Chain A, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 467 Back     alignment and structure
>pdb|1LBD|A Chain A, Ligand-Binding Domain Of The Human Nuclear Receptor Rxr-Alpha Length = 282 Back     alignment and structure
>pdb|1Z5X|U Chain U, Hemipteran Ecdysone Receptor Ligand-Binding Domain Complexed With Ponasterone A Length = 262 Back     alignment and structure
>pdb|3UVV|B Chain B, Crystal Structure Of The Ligand Binding Domains Of The Thyroid Receptor:retinoid X Receptor Complexed With 3,3',5 Triiodo-L- Thyronine And 9-Cis Retinoic Acid Length = 244 Back     alignment and structure
>pdb|3E94|A Chain A, Crystal Structure Of Rxralpha Ligand Binding Domain In Complex With Tributyltin And A Coactivator Fragment Length = 244 Back     alignment and structure
>pdb|1RDT|A Chain A, Crystal Structure Of A New Rexinoid Bound To The Rxralpha Ligand Binding Doamin In The RxralphaPPARGAMMA HETERODIMER Length = 242 Back     alignment and structure
>pdb|3A9E|A Chain A, Crystal Structure Of A Mixed Agonist-Bound Rar-Alpha And Antagonist- Bound Rxr-Alpha Heterodimer Ligand Binding Domains Length = 240 Back     alignment and structure
>pdb|1MV9|A Chain A, Crystal Structure Of The Human Rxr Alpha Ligand Binding Domain Bound To The Eicosanoid Dha (Docosa Hexaenoic Acid) And A Coactivator Peptide Length = 240 Back     alignment and structure
>pdb|1FBY|A Chain A, Crystal Structure Of The Human Rxr Alpha Ligand Binding Domain Bound To 9-Cis Retinoic Acid Length = 239 Back     alignment and structure
>pdb|1XDK|A Chain A, Crystal Structure Of The RarbetaRXRALPHA LIGAND BINDING Domain Heterodimer In Complex With 9-Cis Retinoic Acid And A Fragment Of The Trap220 Coactivator Length = 238 Back     alignment and structure
>pdb|1FM6|A Chain A, The 2.1 Angstrom Resolution Crystal Structure Of The Heterodimer Of The Human Rxralpha And Ppargamma Ligand Binding Domains Respectively Bound With 9-Cis Retinoic Acid And Rosiglitazone And Co-Activator Peptides. Length = 238 Back     alignment and structure
>pdb|1XV9|A Chain A, Crystal Structure Of CarRXR HETERODIMER BOUND WITH SRC1 Peptide, Fatty Acid, And 5b-Pregnane-3,20-Dione. Length = 236 Back     alignment and structure
>pdb|1DKF|A Chain A, Crystal Structure Of A Heterodimeric Complex Of Rar And Rxr Ligand-Binding Domains Length = 233 Back     alignment and structure
>pdb|3PCU|A Chain A, Crystal Structure Of Human Retinoic X Receptor Alpha Ligand-Binding Domain Complexed With Lx0278 And Src1 Peptide Length = 230 Back     alignment and structure
>pdb|3OAP|A Chain A, Crystal Structure Of Human Retinoid X Receptor Alpha-Ligand Binding Domain Complex With 9-Cis Retinoic Acid And The Coactivator Peptide Grip-1 Length = 231 Back     alignment and structure
>pdb|1XLS|A Chain A, Crystal Structure Of The Mouse CarRXR LBD HETERODIMER Bound To Tcpobop And 9cra And A Tif2 Peptide Containg The Third Lxxll Motifs Length = 232 Back     alignment and structure
>pdb|3H0A|A Chain A, Crystal Structure Of Peroxisome Proliferator-Activated Receptor Gamma (Pparg) And Retinoic Acid Receptor Alpha (Rxra) In Complex With 9-Cis Retinoic Acid, Co-Activator Peptide, And A Partial Agonist Length = 228 Back     alignment and structure
>pdb|2GL8|A Chain A, Human Retinoic Acid Receptor Rxr-Gamma Ligand-Binding Domain Length = 241 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
2iz2_A243 FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc 7e-31
2iz2_A243 FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc 3e-10
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 2e-25
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 8e-12
3plz_A257 FTZ-F1 related protein; alpha helical sandwhich, f 4e-25
3plz_A257 FTZ-F1 related protein; alpha helical sandwhich, f 1e-11
1ymt_A246 Steroidogenic factor 1; SF-1, ligand-binding domai 1e-24
1ymt_A246 Steroidogenic factor 1; SF-1, ligand-binding domai 7e-12
3ltx_A243 Estrogen receptor; constitutive, nuclear receptor, 7e-24
3ltx_A243 Estrogen receptor; constitutive, nuclear receptor, 2e-12
2e2r_A244 Estrogen-related receptor gamma; ERR gamma, BPA, n 9e-24
2e2r_A244 Estrogen-related receptor gamma; ERR gamma, BPA, n 3e-12
2p1t_A240 Retinoic acid receptor RXR-alpha; protein-ligand c 9e-24
2p1t_A240 Retinoic acid receptor RXR-alpha; protein-ligand c 2e-10
1lbd_A282 RXR_LBD, retinoid X receptor; transcription factor 2e-23
1lbd_A282 RXR_LBD, retinoid X receptor; transcription factor 4e-10
3k6p_A248 Steroid hormone receptor ERR1; estrogen related re 7e-23
2nxx_A235 Ultraspiracle (USP, NR2B4); hormone receptor, APO 3e-22
2nxx_A235 Ultraspiracle (USP, NR2B4); hormone receptor, APO 4e-11
1g2n_A264 Ultraspiracle protein; antiparallel alpha-helical 1e-20
1g2n_A264 Ultraspiracle protein; antiparallel alpha-helical 9e-12
1pzl_A237 Hepatocyte nuclear factor 4-alpha; transcription; 3e-20
1pzl_A237 Hepatocyte nuclear factor 4-alpha; transcription; 2e-11
3cjw_A244 COUP transcription factor 2; COUP-TFII, nuclear re 4e-19
3cjw_A244 COUP transcription factor 2; COUP-TFII, nuclear re 6e-09
1hg4_A279 Ultraspiracle; nuclear hormone receptor, transcrip 2e-17
1hg4_A279 Ultraspiracle; nuclear hormone receptor, transcrip 2e-10
1t7r_A269 Androgen receptor; nuclear receptor, transcription 4e-17
1t7r_A269 Androgen receptor; nuclear receptor, transcription 9e-08
3oll_A240 Estrogen receptor beta; steroid binding, phosphory 2e-16
3p0u_A249 Nuclear receptor subfamily 2 group C member 2; lig 7e-16
3p0u_A249 Nuclear receptor subfamily 2 group C member 2; lig 2e-09
3mnp_A261 Glucocorticoid receptor; protein-ligand complex, s 3e-15
3mnp_A261 Glucocorticoid receptor; protein-ligand complex, s 1e-07
1l2j_A271 Estrogen receptor beta; nuclear receptor, transcri 7e-15
1yye_A268 ER-beta, estrogen receptor beta; ER-beta, nuclear 1e-14
1xpc_A248 Estrogen receptor; nuclear receptor, transcription 2e-14
1xpc_A248 Estrogen receptor; nuclear receptor, transcription 1e-06
2ocf_A298 Estrogen receptor; estrogen receptor, LBD, monobod 4e-14
2ocf_A298 Estrogen receptor; estrogen receptor, LBD, monobod 2e-08
3f5c_B268 Nuclear receptor subfamily 0 group B member 1; tra 7e-14
3f5c_B268 Nuclear receptor subfamily 0 group B member 1; tra 3e-08
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 1e-13
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-07
1sqn_A261 PR, progesterone receptor; nuclear receptor, stero 4e-13
1sqn_A261 PR, progesterone receptor; nuclear receptor, stero 3e-08
3vhv_A260 Mineralocorticoid receptor; nuclear receptor, tran 2e-12
3vhv_A260 Mineralocorticoid receptor; nuclear receptor, tran 1e-05
3vhu_A294 Mineralocorticoid receptor; nuclear receptor, tran 3e-11
3vhu_A294 Mineralocorticoid receptor; nuclear receptor, tran 6e-05
1ovl_A271 Orphan nuclear receptor NURR1 (MSe 414, 496, 511); 3e-11
1ovl_A271 Orphan nuclear receptor NURR1 (MSe 414, 496, 511); 6e-06
1yje_A264 Orphan nuclear receptor NR4A1; NGFI-B, NUR77, liga 1e-10
1yje_A264 Orphan nuclear receptor NR4A1; NGFI-B, NUR77, liga 3e-05
3kmr_A266 Retinoic acid receptor alpha; nuclear receptor tra 1e-10
3kmr_A266 Retinoic acid receptor alpha; nuclear receptor tra 8e-08
1pdu_A244 DHR38, nuclear hormone receptor HR38; nuclear rece 2e-09
1pdu_A244 DHR38, nuclear hormone receptor HR38; nuclear rece 9e-06
1fcy_A236 RAR-gamma-1, retinoic acid receptor gamma-1; isoty 7e-09
1fcy_A236 RAR-gamma-1, retinoic acid receptor gamma-1; isoty 6e-08
3dzy_D419 Peroxisome proliferator-activated receptor gamma; 3e-08
3dzy_D419 Peroxisome proliferator-activated receptor gamma; 2e-06
3cqv_A199 Nuclear receptor subfamily 1 group D member 2; rev 3e-08
3cqv_A199 Nuclear receptor subfamily 1 group D member 2; rev 1e-06
3n00_A245 REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s 4e-08
3n00_A245 REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s 1e-06
1xdk_B303 RAR-beta, retinoic acid receptor, beta; nuclear re 4e-08
1xdk_B303 RAR-beta, retinoic acid receptor, beta; nuclear re 2e-07
1nrl_A316 Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- 1e-07
1nrl_A316 Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- 4e-04
3u9q_A269 Peroxisome proliferator-activated receptor gamma; 1e-07
3u9q_A269 Peroxisome proliferator-activated receptor gamma; 3e-06
3ipq_A283 Oxysterols receptor LXR-alpha; LXR homodimer, LXR 1e-07
3ipq_A283 Oxysterols receptor LXR-alpha; LXR homodimer, LXR 2e-05
2hc4_A302 Vitamin D receptor; alpha helical sandwich, gene r 2e-07
2hc4_A302 Vitamin D receptor; alpha helical sandwich, gene r 3e-06
2p54_A267 PPAR-alpha, peroxisome proliferator-activated rece 6e-07
1osh_A232 BIle acid receptor; nuclear receptor, ligand bindi 6e-07
1osh_A232 BIle acid receptor; nuclear receptor, ligand bindi 2e-05
1z5x_E310 Ecdysone receptor ligand binding domain; ponastero 1e-06
1nq7_A244 Nuclear receptor ROR-beta; ligand-binding domain, 2e-06
1nq7_A244 Nuclear receptor ROR-beta; ligand-binding domain, 2e-05
3b0t_A254 Vitamin D3 receptor; nuclear receptor, transcripti 3e-06
3b0t_A254 Vitamin D3 receptor; nuclear receptor, transcripti 2e-04
1xvp_B246 Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR 3e-06
1xvp_B246 Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR 3e-04
3ilz_A267 Thyroid hormone receptor, alpha isoform 1 variant; 6e-06
3ilz_A267 Thyroid hormone receptor, alpha isoform 1 variant; 3e-05
3l0l_A248 Nuclear receptor ROR-gamma; nuclear receptor, rorg 7e-06
1n83_A270 Nuclear receptor ROR-alpha; three-layered alpha he 1e-05
2o4j_A292 Vitamin D3 receptor; nuclear receptor-ligand compl 2e-05
2o4j_A292 Vitamin D3 receptor; nuclear receptor-ligand compl 3e-05
2r40_D266 Ecdysone receptor, 20-hydroxy-ecdysone receptor; n 2e-05
2r40_D266 Ecdysone receptor, 20-hydroxy-ecdysone receptor; n 2e-04
2nxx_E248 Ecdysone receptor (ECR, NRH1); hormone receptor, A 5e-05
3up3_A243 Acedaf-12; ligand binding domain, nematode, steroi 4e-04
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Length = 257 Back     alignment and structure
>3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Length = 257 Back     alignment and structure
>1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Length = 246 Back     alignment and structure
>1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Length = 246 Back     alignment and structure
>3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Length = 243 Back     alignment and structure
>3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Length = 243 Back     alignment and structure
>2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Length = 244 Back     alignment and structure
>2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Length = 244 Back     alignment and structure
>2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Length = 240 Back     alignment and structure
>2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Length = 240 Back     alignment and structure
>1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Length = 282 Back     alignment and structure
>1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Length = 282 Back     alignment and structure
>3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} PDB: 1xb7_A 2pjl_A* 3d24_A Length = 248 Back     alignment and structure
>2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 235 Back     alignment and structure
>2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 235 Back     alignment and structure
>1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* Length = 264 Back     alignment and structure
>1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* Length = 264 Back     alignment and structure
>1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Length = 237 Back     alignment and structure
>1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Length = 237 Back     alignment and structure
>3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Length = 244 Back     alignment and structure
>3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Length = 244 Back     alignment and structure
>1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 279 Back     alignment and structure
>1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 279 Back     alignment and structure
>1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Length = 269 Back     alignment and structure
>1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Length = 269 Back     alignment and structure
>3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... Length = 240 Back     alignment and structure
>3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} Length = 249 Back     alignment and structure
>3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} Length = 249 Back     alignment and structure
>3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Length = 261 Back     alignment and structure
>3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Length = 261 Back     alignment and structure
>1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 Length = 271 Back     alignment and structure
>1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* Length = 268 Back     alignment and structure
>1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Length = 248 Back     alignment and structure
>1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Length = 248 Back     alignment and structure
>2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 298 Back     alignment and structure
>2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 298 Back     alignment and structure
>3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} Length = 268 Back     alignment and structure
>3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} Length = 268 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* Length = 261 Back     alignment and structure
>1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* Length = 261 Back     alignment and structure
>3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* Length = 260 Back     alignment and structure
>3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* Length = 260 Back     alignment and structure
>3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} Length = 294 Back     alignment and structure
>3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} Length = 294 Back     alignment and structure
>1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Length = 271 Back     alignment and structure
>1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Length = 271 Back     alignment and structure
>1yje_A Orphan nuclear receptor NR4A1; NGFI-B, NUR77, ligand-binding domain, novel coregulator interface, cell-specific; 2.40A {Rattus norvegicus} PDB: 2qw4_A Length = 264 Back     alignment and structure
>1yje_A Orphan nuclear receptor NR4A1; NGFI-B, NUR77, ligand-binding domain, novel coregulator interface, cell-specific; 2.40A {Rattus norvegicus} PDB: 2qw4_A Length = 264 Back     alignment and structure
>3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* Length = 266 Back     alignment and structure
>3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* Length = 266 Back     alignment and structure
>1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 244 Back     alignment and structure
>1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 244 Back     alignment and structure
>1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* Length = 236 Back     alignment and structure
>1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* Length = 236 Back     alignment and structure
>3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 Back     alignment and structure
>3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 Back     alignment and structure
>3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A Length = 199 Back     alignment and structure
>3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A Length = 199 Back     alignment and structure
>3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} Length = 245 Back     alignment and structure
>3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} Length = 245 Back     alignment and structure
>1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 Length = 303 Back     alignment and structure
>1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 Length = 303 Back     alignment and structure
>1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* Length = 316 Back     alignment and structure
>1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* Length = 316 Back     alignment and structure
>3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... Length = 269 Back     alignment and structure
>3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... Length = 269 Back     alignment and structure
>3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* Length = 283 Back     alignment and structure
>3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* Length = 283 Back     alignment and structure
>2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Length = 302 Back     alignment and structure
>2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Length = 302 Back     alignment and structure
>2p54_A PPAR-alpha, peroxisome proliferator-activated receptor alpha; PPAR alpha GW735 SRC1 agonist HDLC, transcription; HET: 735; 1.79A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fei_A* 1i7g_A* 3kdu_A* 3kdt_A* 2rew_A* 1kkq_A* 3g8i_A* 3et1_A* 2znn_A* 3sp6_A* 1k7l_A* 2npa_A* 2xyj_A* 2xyw_A* 2xyx_A* 2q5g_A* 3gwx_A* 3dy6_A* 1gwx_A* 3peq_A* ... Length = 267 Back     alignment and structure
>1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... Length = 232 Back     alignment and structure
>1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... Length = 232 Back     alignment and structure
>1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} Length = 310 Back     alignment and structure
>1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* Length = 244 Back     alignment and structure
>1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* Length = 244 Back     alignment and structure
>3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... Length = 254 Back     alignment and structure
>3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... Length = 254 Back     alignment and structure
>1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* Length = 246 Back     alignment and structure
>1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* Length = 246 Back     alignment and structure
>3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... Length = 267 Back     alignment and structure
>3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... Length = 267 Back     alignment and structure
>3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} PDB: 3b0w_A* 3kyt_A* 3l0j_A* Length = 248 Back     alignment and structure
>1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* Length = 270 Back     alignment and structure
>2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* Length = 292 Back     alignment and structure
>2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* Length = 292 Back     alignment and structure
>2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* Length = 266 Back     alignment and structure
>2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* Length = 266 Back     alignment and structure
>2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 248 Back     alignment and structure
>3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* Length = 243 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
3plz_A257 FTZ-F1 related protein; alpha helical sandwhich, f 99.95
3v3e_B257 Nuclear receptor subfamily 4 group A member 1; orp 99.94
3oll_A240 Estrogen receptor beta; steroid binding, phosphory 99.94
3ltx_A243 Estrogen receptor; constitutive, nuclear receptor, 99.94
2iz2_A243 FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc 99.94
2e2r_A244 Estrogen-related receptor gamma; ERR gamma, BPA, n 99.94
3k6p_A248 Steroid hormone receptor ERR1; estrogen related re 99.94
1ymt_A246 Steroidogenic factor 1; SF-1, ligand-binding domai 99.93
1fcy_A236 RAR-gamma-1, retinoic acid receptor gamma-1; isoty 99.93
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 99.93
1l2j_A271 Estrogen receptor beta; nuclear receptor, transcri 99.93
1xpc_A248 Estrogen receptor; nuclear receptor, transcription 99.93
3kmr_A266 Retinoic acid receptor alpha; nuclear receptor tra 99.93
3f5c_B268 Nuclear receptor subfamily 0 group B member 1; tra 99.92
1xdk_B303 RAR-beta, retinoic acid receptor, beta; nuclear re 99.92
2ocf_A298 Estrogen receptor; estrogen receptor, LBD, monobod 99.92
1yye_A268 ER-beta, estrogen receptor beta; ER-beta, nuclear 99.92
1g2n_A264 Ultraspiracle protein; antiparallel alpha-helical 99.92
3ilz_A267 Thyroid hormone receptor, alpha isoform 1 variant; 99.92
1pdu_A244 DHR38, nuclear hormone receptor HR38; nuclear rece 99.92
2p1t_A240 Retinoic acid receptor RXR-alpha; protein-ligand c 99.91
2r40_D266 Ecdysone receptor, 20-hydroxy-ecdysone receptor; n 99.91
3p0u_A249 Nuclear receptor subfamily 2 group C member 2; lig 99.91
2nxx_A235 Ultraspiracle (USP, NR2B4); hormone receptor, APO 99.91
2nxx_E248 Ecdysone receptor (ECR, NRH1); hormone receptor, A 99.9
1lbd_A282 RXR_LBD, retinoid X receptor; transcription factor 99.9
1nq7_A244 Nuclear receptor ROR-beta; ligand-binding domain, 99.9
1ovl_A271 Orphan nuclear receptor NURR1 (MSe 414, 496, 511); 99.9
3cjw_A244 COUP transcription factor 2; COUP-TFII, nuclear re 99.9
1z5x_E310 Ecdysone receptor ligand binding domain; ponastero 99.9
1hg4_A279 Ultraspiracle; nuclear hormone receptor, transcrip 99.9
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 99.89
1n83_A270 Nuclear receptor ROR-alpha; three-layered alpha he 99.89
3b0t_A254 Vitamin D3 receptor; nuclear receptor, transcripti 99.89
3vi8_A273 Peroxisome proliferator-activated receptor alpha; 99.89
3l0l_A248 Nuclear receptor ROR-gamma; nuclear receptor, rorg 99.89
3vhv_A260 Mineralocorticoid receptor; nuclear receptor, tran 99.89
1t7r_A269 Androgen receptor; nuclear receptor, transcription 99.89
2o4j_A292 Vitamin D3 receptor; nuclear receptor-ligand compl 99.89
3ipq_A283 Oxysterols receptor LXR-alpha; LXR homodimer, LXR 99.88
1nrl_A316 Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- 99.88
1xvp_B246 Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR 99.88
3up3_A243 Acedaf-12; ligand binding domain, nematode, steroi 99.88
1sqn_A261 PR, progesterone receptor; nuclear receptor, stero 99.88
3vhu_A294 Mineralocorticoid receptor; nuclear receptor, tran 99.88
2hc4_A302 Vitamin D receptor; alpha helical sandwich, gene r 99.88
3mnp_A261 Glucocorticoid receptor; protein-ligand complex, s 99.87
1osh_A232 BIle acid receptor; nuclear receptor, ligand bindi 99.87
3u9q_A269 Peroxisome proliferator-activated receptor gamma; 99.86
1pzl_A237 Hepatocyte nuclear factor 4-alpha; transcription; 99.86
3cqv_A199 Nuclear receptor subfamily 1 group D member 2; rev 99.84
3dzy_D419 Peroxisome proliferator-activated receptor gamma; 99.83
3n00_A245 REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s 99.8
3gyt_A244 Nuclear hormone receptor of the steroid/thyroid ho 99.78
3vi8_A273 Peroxisome proliferator-activated receptor alpha; 99.17
3cqv_A199 Nuclear receptor subfamily 1 group D member 2; rev 99.12
3dzy_D419 Peroxisome proliferator-activated receptor gamma; 99.11
3u9q_A269 Peroxisome proliferator-activated receptor gamma; 99.09
1fcy_A236 RAR-gamma-1, retinoic acid receptor gamma-1; isoty 99.09
1nq7_A244 Nuclear receptor ROR-beta; ligand-binding domain, 99.07
3ltx_A243 Estrogen receptor; constitutive, nuclear receptor, 99.06
3ilz_A267 Thyroid hormone receptor, alpha isoform 1 variant; 99.06
1osh_A232 BIle acid receptor; nuclear receptor, ligand bindi 99.05
2iz2_A243 FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc 99.05
1xvp_B246 Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR 99.04
2hc4_A302 Vitamin D receptor; alpha helical sandwich, gene r 99.04
2e2r_A244 Estrogen-related receptor gamma; ERR gamma, BPA, n 99.04
3f5c_B268 Nuclear receptor subfamily 0 group B member 1; tra 99.04
3b0t_A254 Vitamin D3 receptor; nuclear receptor, transcripti 99.04
3n00_A245 REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s 99.04
3kmr_A266 Retinoic acid receptor alpha; nuclear receptor tra 99.04
3l0l_A248 Nuclear receptor ROR-gamma; nuclear receptor, rorg 99.03
3p0u_A249 Nuclear receptor subfamily 2 group C member 2; lig 99.03
1n83_A270 Nuclear receptor ROR-alpha; three-layered alpha he 99.03
1g2n_A264 Ultraspiracle protein; antiparallel alpha-helical 99.02
1ymt_A246 Steroidogenic factor 1; SF-1, ligand-binding domai 99.02
1nrl_A316 Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- 99.02
3plz_A257 FTZ-F1 related protein; alpha helical sandwhich, f 99.02
3k6p_A248 Steroid hormone receptor ERR1; estrogen related re 99.02
3cjw_A244 COUP transcription factor 2; COUP-TFII, nuclear re 99.02
2nxx_A235 Ultraspiracle (USP, NR2B4); hormone receptor, APO 99.01
2o4j_A292 Vitamin D3 receptor; nuclear receptor-ligand compl 99.01
3ipq_A283 Oxysterols receptor LXR-alpha; LXR homodimer, LXR 98.99
1hg4_A279 Ultraspiracle; nuclear hormone receptor, transcrip 98.98
1xdk_B303 RAR-beta, retinoic acid receptor, beta; nuclear re 98.96
3vhv_A260 Mineralocorticoid receptor; nuclear receptor, tran 98.93
3v3e_B257 Nuclear receptor subfamily 4 group A member 1; orp 98.93
3mnp_A261 Glucocorticoid receptor; protein-ligand complex, s 98.92
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 98.9
1lbd_A282 RXR_LBD, retinoid X receptor; transcription factor 98.89
2p1t_A240 Retinoic acid receptor RXR-alpha; protein-ligand c 98.88
3up3_A243 Acedaf-12; ligand binding domain, nematode, steroi 98.88
2r40_D266 Ecdysone receptor, 20-hydroxy-ecdysone receptor; n 98.87
1sqn_A261 PR, progesterone receptor; nuclear receptor, stero 98.86
3vhu_A294 Mineralocorticoid receptor; nuclear receptor, tran 98.84
1t7r_A269 Androgen receptor; nuclear receptor, transcription 98.83
1pdu_A244 DHR38, nuclear hormone receptor HR38; nuclear rece 98.8
2nxx_E248 Ecdysone receptor (ECR, NRH1); hormone receptor, A 98.78
1z5x_E310 Ecdysone receptor ligand binding domain; ponastero 98.74
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 98.72
2ocf_A298 Estrogen receptor; estrogen receptor, LBD, monobod 98.71
1yye_A268 ER-beta, estrogen receptor beta; ER-beta, nuclear 98.7
1ovl_A271 Orphan nuclear receptor NURR1 (MSe 414, 496, 511); 98.7
3oll_A240 Estrogen receptor beta; steroid binding, phosphory 98.7
1pzl_A237 Hepatocyte nuclear factor 4-alpha; transcription; 98.69
1xpc_A248 Estrogen receptor; nuclear receptor, transcription 98.68
3gyt_A244 Nuclear hormone receptor of the steroid/thyroid ho 98.67
1l2j_A271 Estrogen receptor beta; nuclear receptor, transcri 98.62
>3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Back     alignment and structure
Probab=99.95  E-value=1.1e-26  Score=187.21  Aligned_cols=151  Identities=34%  Similarity=0.569  Sum_probs=137.3

Q ss_pred             CCCHHHHHHhHHHHHHhHhhhh--hhcCCCcchhHHHHHHHHhhHHHHHHHHHHHHhhcCCCCcEEeeCCcccchhhhh-
Q psy12692         37 ILNRTHVEEGHEQVQKALLDYC--ITAYPQIQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQKFDLLSLG-  113 (187)
Q Consensus        37 l~~~~~V~~l~~~~l~~Lv~~~--~~~f~~l~~~DQ~~LL~~~w~el~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-  113 (187)
                      ....+.+++++++.+..+++|+  .|.|.+++.+||++||+++|.|+++++.|+|+++....+.+.+.+|..++.+... 
T Consensus        55 ~~~~~~l~~~a~~~l~~~VewaK~ip~F~~L~~~DQ~~LLk~~~~el~lL~~a~rs~~~~~~~~l~~~~g~~~~~~~~~~  134 (257)
T 3plz_A           55 LSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIAS  134 (257)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHSTTGGGSCHHHHHHHHHHHHHHHHHHHHHHHHHHHCBTTEEECTTSCEEEHHHHHT
T ss_pred             cchHHHHHHHHHHHHHHHHHHHHcCcChhcCCHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCeEEecCCCccChHHHhh
Confidence            4557889999999999999999  8999999999999999999999999999999998765688999999998877654 


Q ss_pred             hcCh--HHHHHHHHHHHHHHhccCCCc-----------------------------------------------cchHHH
Q psy12692        114 LLGV--PTLRDRFTQVTHKLSELKFPN-----------------------------------------------CDKFGK  144 (187)
Q Consensus       114 ~~~~--~~~~~~l~~~~~~l~~L~ld~-----------------------------------------------~~r~~~  144 (187)
                      ..|.  .++++.+++++.+|++|++|+                                               +.||++
T Consensus       135 ~~g~~~~~~~~~l~~~~~~l~~L~ld~~E~~lLkAivL~npd~~gL~~~~~ve~lq~~~~~aL~~y~~~~~p~~~~Rf~~  214 (257)
T 3plz_A          135 QAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQ  214 (257)
T ss_dssp             TSCHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHSCTTCCSCTTHHHHHHHHHHHHHHHHHHHHHHCTTSTTHHHH
T ss_pred             hcCCcHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHhcCCCCCCccHHHHHHHHHHHHHHHHHHHHHhCCCchhHHHH
Confidence            5555  678899999999999999998                                               799999


Q ss_pred             HHHhChhhHhhhHHHHHHHHHHhhcCCCChhhHHHHHHhcCCC
Q psy12692        145 LMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHAKRK  187 (187)
Q Consensus       145 Lll~lp~lr~ls~~~~e~l~~~~~~g~~~~~~ll~eml~~~~~  187 (187)
                      ||+.+|++|+++.+++|++++++++|.+|+++|+.||++++|+
T Consensus       215 LL~~Lp~Lr~l~~~~~e~l~~~~~~g~~~i~~Ll~Eml~~k~~  257 (257)
T 3plz_A          215 LLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA  257 (257)
T ss_dssp             HHTHHHHHHHHHHHHHHHHHHHHHTTCSCCCSHHHHHHTC---
T ss_pred             HHHHhHHHHHHHHHHHHHHhhhhhcCCCCHHHHHHHHHhcccC
Confidence            9999999999999999999999999999999999999999985



>3v3e_B Nuclear receptor subfamily 4 group A member 1; orphan nuclear receptor, transcription; 2.06A {Homo sapiens} PDB: 3v3q_A* 2qw4_A 1yje_A Back     alignment and structure
>3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} SCOP: a.123.1.1 PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... Back     alignment and structure
>3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Back     alignment and structure
>2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Back     alignment and structure
>3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xb7_A 2pjl_A* 3d24_A Back     alignment and structure
>1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Back     alignment and structure
>1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Back     alignment and structure
>1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 Back     alignment and structure
>1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Back     alignment and structure
>3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* Back     alignment and structure
>3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} Back     alignment and structure
>1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 Back     alignment and structure
>2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* Back     alignment and structure
>1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* Back     alignment and structure
>3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} SCOP: a.123.1.1 PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... Back     alignment and structure
>1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 Back     alignment and structure
>2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Back     alignment and structure
>2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* Back     alignment and structure
>3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} Back     alignment and structure
>2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Back     alignment and structure
>2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Back     alignment and structure
>1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Back     alignment and structure
>1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* Back     alignment and structure
>1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Back     alignment and structure
>3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Back     alignment and structure
>1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} Back     alignment and structure
>1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Back     alignment and structure
>1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* Back     alignment and structure
>3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... Back     alignment and structure
>3vi8_A Peroxisome proliferator-activated receptor alpha; nuclear receptor, protein-ligand complex, PPAR, transcriptio; HET: 13M; 1.75A {Homo sapiens} PDB: 2znn_A* 3et1_A* 3kdu_A* 3kdt_A* 2rew_A* 1i7g_A* 3g8i_A* 1kkq_A* 1k7l_A* 3sp6_A* 2npa_A* 2p54_A* 3fei_A* 3tkm_A* 2znq_A* 2znp_A* 3sp9_A* 3gwx_A* 3dy6_A* 1gwx_A* ... Back     alignment and structure
>3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} SCOP: a.123.1.0 PDB: 3b0w_A* 3kyt_A* 3l0j_A* Back     alignment and structure
>3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} SCOP: a.123.1.1 PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* 4fne_A* 4fn9_A* Back     alignment and structure
>1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Back     alignment and structure
>2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* Back     alignment and structure
>3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* Back     alignment and structure
>1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* Back     alignment and structure
>1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* Back     alignment and structure
>3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* Back     alignment and structure
>1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* Back     alignment and structure
>3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} Back     alignment and structure
>2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Back     alignment and structure
>3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} SCOP: a.123.1.1 PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Back     alignment and structure
>1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... Back     alignment and structure
>3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} SCOP: a.123.1.1 PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... Back     alignment and structure
>1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Back     alignment and structure
>3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A Back     alignment and structure
>3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Back     alignment and structure
>3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} Back     alignment and structure
>3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* Back     alignment and structure
>3vi8_A Peroxisome proliferator-activated receptor alpha; nuclear receptor, protein-ligand complex, PPAR, transcriptio; HET: 13M; 1.75A {Homo sapiens} PDB: 2znn_A* 3et1_A* 3kdu_A* 3kdt_A* 2rew_A* 1i7g_A* 3g8i_A* 1kkq_A* 1k7l_A* 3sp6_A* 2npa_A* 2p54_A* 3fei_A* 3tkm_A* 2znq_A* 2znp_A* 3sp9_A* 3gwx_A* 3dy6_A* 1gwx_A* ... Back     alignment and structure
>3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A Back     alignment and structure
>3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Back     alignment and structure
>3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} SCOP: a.123.1.1 PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... Back     alignment and structure
>1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* Back     alignment and structure
>1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* Back     alignment and structure
>3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Back     alignment and structure
>3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} SCOP: a.123.1.1 PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... Back     alignment and structure
>1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... Back     alignment and structure
>1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* Back     alignment and structure
>2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Back     alignment and structure
>2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Back     alignment and structure
>3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} Back     alignment and structure
>3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... Back     alignment and structure
>3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} Back     alignment and structure
>3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* Back     alignment and structure
>3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} SCOP: a.123.1.0 PDB: 3b0w_A* 3kyt_A* 3l0j_A* Back     alignment and structure
>3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} Back     alignment and structure
>1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* Back     alignment and structure
>1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* Back     alignment and structure
>1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Back     alignment and structure
>1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* Back     alignment and structure
>3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Back     alignment and structure
>3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xb7_A 2pjl_A* 3d24_A Back     alignment and structure
>3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Back     alignment and structure
>2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Back     alignment and structure
>2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* Back     alignment and structure
>3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* Back     alignment and structure
>1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 Back     alignment and structure
>1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 Back     alignment and structure
>3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} SCOP: a.123.1.1 PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* 4fne_A* 4fn9_A* Back     alignment and structure
>3v3e_B Nuclear receptor subfamily 4 group A member 1; orphan nuclear receptor, transcription; 2.06A {Homo sapiens} PDB: 3v3q_A* 2qw4_A 1yje_A Back     alignment and structure
>3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} SCOP: a.123.1.1 PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Back     alignment and structure
>1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Back     alignment and structure
>2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Back     alignment and structure
>3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* Back     alignment and structure
>2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* Back     alignment and structure
>1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* Back     alignment and structure
>3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} Back     alignment and structure
>1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Back     alignment and structure
>1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 Back     alignment and structure
>2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Back     alignment and structure
>1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Back     alignment and structure
>2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* Back     alignment and structure
>1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Back     alignment and structure
>3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} SCOP: a.123.1.1 PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... Back     alignment and structure
>1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Back     alignment and structure
>1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Back     alignment and structure
>3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* Back     alignment and structure
>1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 187
d1pk5a_242 a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH- 5e-18
d1pk5a_242 a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH- 4e-07
d3d24a1227 a.123.1.1 (A:194-420) Steroid hormone receptor ERR 4e-14
d3d24a1227 a.123.1.1 (A:194-420) Steroid hormone receptor ERR 4e-07
d2e2ra1223 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 9e-14
d2e2ra1223 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 1e-04
d2p1ta1230 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (R 1e-13
d2p1ta1230 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (R 1e-04
d1hg4a_265 a.123.1.1 (A:) Ultraspiracle protein, usp {Drosoph 8e-13
d1hg4a_265 a.123.1.1 (A:) Ultraspiracle protein, usp {Drosoph 2e-06
d1fcya_236 a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-g 1e-12
d1fcya_236 a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-g 6e-06
d1xpca_245 a.123.1.1 (A:) Estrogen receptor alpha {Human (Hom 1e-11
d1xpca_245 a.123.1.1 (A:) Estrogen receptor alpha {Human (Hom 0.001
d1pzla_233 a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha { 2e-11
d1pzla_233 a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha { 7e-07
d1g2na_256 a.123.1.1 (A:) Ultraspiracle protein, usp {Helioth 6e-11
d1g2na_256 a.123.1.1 (A:) Ultraspiracle protein, usp {Helioth 6e-06
d1pdua_230 a.123.1.1 (A:) Nuclear hormone receptor HR38 {Frui 1e-10
d2j7ya1236 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat 1e-10
d2j7ya1236 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat 0.001
d2qw4a1233 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 9e-10
d1n46a_251 a.123.1.1 (A:) Thyroid hormone receptor beta (TR-b 1e-08
d1n46a_251 a.123.1.1 (A:) Thyroid hormone receptor beta (TR-b 6e-06
d1t7ra_250 a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan 1e-08
d1t7ra_250 a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan 8e-05
d1ovla_236 a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Huma 2e-08
d1ovla_236 a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Huma 4e-04
d2b50b1265 a.123.1.1 (B:211-475) Peroxisome proliferator-acti 2e-08
d2b50b1265 a.123.1.1 (B:211-475) Peroxisome proliferator-acti 8e-06
d1sqna_251 a.123.1.1 (A:) Progesterone receptor {Human (Homo 7e-08
d1sqna_251 a.123.1.1 (A:) Progesterone receptor {Human (Homo 6e-05
d1nhza_247 a.123.1.1 (A:) Glucocorticoid receptor {Human (Hom 1e-07
d1nhza_247 a.123.1.1 (A:) Glucocorticoid receptor {Human (Hom 3e-05
d2fvja1271 a.123.1.1 (A:207-477) Peroxisome proliferator acti 4e-07
d2fvja1271 a.123.1.1 (A:207-477) Peroxisome proliferator acti 1e-05
d1ie9a_255 a.123.1.1 (A:) Vitamin D nuclear receptor {Human ( 6e-07
d1ie9a_255 a.123.1.1 (A:) Vitamin D nuclear receptor {Human ( 5e-06
d1pq9a_239 a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human 8e-07
d1pq9a_239 a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human 2e-05
d1nrla_292 a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Ho 2e-06
d1nrla_292 a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Ho 4e-06
d2p54a1267 a.123.1.1 (A:202-468) Peroxisome proliferator acti 2e-06
d2p54a1267 a.123.1.1 (A:202-468) Peroxisome proliferator acti 2e-05
d1nq7a_244 a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {R 2e-06
d1nq7a_244 a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {R 3e-04
d1n83a_251 a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha { 4e-06
d1n83a_251 a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha { 7e-04
d1xvpb_246 a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) 6e-06
d1xvpb_246 a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) 1e-04
d1xnxa_232 a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) 7e-06
d2r40d1243 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid m 7e-06
d2r40d1243 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid m 0.001
d1osha_231 a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo 2e-05
d1osha_231 a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo 2e-05
>d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure

class: All alpha proteins
fold: Nuclear receptor ligand-binding domain
superfamily: Nuclear receptor ligand-binding domain
family: Nuclear receptor ligand-binding domain
domain: Orphan nuclear receptor NR5a2 (LRH-1)
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 76.6 bits (188), Expect = 5e-18
 Identities = 48/178 (26%), Positives = 79/178 (44%), Gaps = 50/178 (28%)

Query: 59  ITAYPQIQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQ------------- 105
              + +++VDDQMKLLQ+ WS++L+LDH+++++ +       L  G+             
Sbjct: 65  SIFFRELKVDDQMKLLQNCWSELLILDHIYRQVAHGKEGTIFLVTGEHVDYSTIISHTEV 124

Query: 106 -------------------KFDLLSLGLLG-----------------VPTLRDRFTQVTH 129
                              +FD      L                  V  ++++      
Sbjct: 125 AFNNLLSLAQELVVRLRSLQFDQREFVCLKFLVLFSSDVKNLENLQLVEGVQEQVNAALL 184

Query: 130 KLSELKFPNC-DKFGKLMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHAKR 186
             +   +P   +KFG+L+  LPEL  I+ + E++LY+KH NG  P   LL+EMLHAKR
Sbjct: 185 DYTVCNYPQQTEKFGQLLLRLPELRAISKQAEDYLYYKHVNGDVPYNNLLIEMLHAKR 242


>d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 227 Back     information, alignment and structure
>d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 227 Back     information, alignment and structure
>d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} Length = 230 Back     information, alignment and structure
>d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} Length = 230 Back     information, alignment and structure
>d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Length = 265 Back     information, alignment and structure
>d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Length = 265 Back     information, alignment and structure
>d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} Length = 256 Back     information, alignment and structure
>d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} Length = 256 Back     information, alignment and structure
>d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 230 Back     information, alignment and structure
>d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} Length = 250 Back     information, alignment and structure
>d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} Length = 250 Back     information, alignment and structure
>d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} Length = 265 Back     information, alignment and structure
>d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} Length = 265 Back     information, alignment and structure
>d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure
>d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure
>d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 255 Back     information, alignment and structure
>d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 255 Back     information, alignment and structure
>d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} Length = 239 Back     information, alignment and structure
>d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} Length = 239 Back     information, alignment and structure
>d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure
>d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure
>d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 244 Back     information, alignment and structure
>d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 244 Back     information, alignment and structure
>d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} Length = 246 Back     information, alignment and structure
>d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} Length = 246 Back     information, alignment and structure
>d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} Length = 232 Back     information, alignment and structure
>d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} Length = 243 Back     information, alignment and structure
>d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} Length = 243 Back     information, alignment and structure
>d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} Length = 231 Back     information, alignment and structure
>d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} Length = 231 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
d1pk5a_242 Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus 99.96
d3d24a1227 Steroid hormone receptor ERR1 {Human (Homo sapiens 99.95
d1g2na_256 Ultraspiracle protein, usp {Heliothis virescens [T 99.95
d2e2ra1223 Orphan nuclear receptor ERR3 {Human (Homo sapiens) 99.95
d1xpca_245 Estrogen receptor alpha {Human (Homo sapiens) [Tax 99.94
d2j7ya1236 Estrogen receptor beta {Rat (Rattus norvegicus) [T 99.94
d1hg4a_265 Ultraspiracle protein, usp {Drosophila melanogaste 99.93
d1pzla_233 Hepatocyte nuclear factor 4-alpha {Human (Homo sap 99.93
d1pdua_230 Nuclear hormone receptor HR38 {Fruit fly (Drosophi 99.93
d1ovla_236 Orphan nuclear receptor NURR1 {Human (Homo sapiens 99.92
d2qw4a1233 Orphan nuclear receptor NR4A1 {Human (Homo sapiens 99.92
d1fcya_236 Retinoic acid receptor gamma (RAR-gamma) {Human (H 99.92
d2p1ta1230 Retinoid-X receptor alpha (RXR-alpha) {Human (Homo 99.91
d1n46a_251 Thyroid hormone receptor beta (TR-beta) {Human (Ho 99.9
d1pq9a_239 Oxysterols receptor LXR-beta {Human (Homo sapiens) 99.9
d1t7ra_250 Androgen receptor {Chimpanzee (Pan troglodytes) [T 99.9
d2r40d1243 Ecdysone receptor {Noctuid moth (Heliothis viresce 99.89
d1sqna_251 Progesterone receptor {Human (Homo sapiens) [TaxId 99.88
d1nhza_247 Glucocorticoid receptor {Human (Homo sapiens) [Tax 99.87
d1xvpb_246 Orphan nuclear receptor NR1I3 (CAR) {Human (Homo s 99.86
d1osha_231 Bile acid receptor FXR {Human (Homo sapiens) [TaxI 99.85
d1n83a_251 Orphan nuclear receptor ROR-alpha {Human (Homo sap 99.84
d2b50b1265 Peroxisome proliferator-activated receptor delta, 99.83
d1nq7a_244 Orphan nuclear receptor ROR-beta {Rat (Rattus norv 99.83
d2fvja1271 Peroxisome proliferator activated receptor gamma, 99.83
d1ie9a_255 Vitamin D nuclear receptor {Human (Homo sapiens) [ 99.83
d2p54a1267 Peroxisome proliferator activated receptor alpha, 99.83
d1nrla_292 Pregnane x receptor, PXR {Human (Homo sapiens) [Ta 99.81
d1xnxa_232 Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus mu 99.8
d1xnxa_232 Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus mu 99.18
d1osha_231 Bile acid receptor FXR {Human (Homo sapiens) [TaxI 99.17
d1g2na_256 Ultraspiracle protein, usp {Heliothis virescens [T 99.13
d1ie9a_255 Vitamin D nuclear receptor {Human (Homo sapiens) [ 99.11
d1xvpb_246 Orphan nuclear receptor NR1I3 (CAR) {Human (Homo s 99.11
d1n46a_251 Thyroid hormone receptor beta (TR-beta) {Human (Ho 99.1
d1nrla_292 Pregnane x receptor, PXR {Human (Homo sapiens) [Ta 99.09
d1pq9a_239 Oxysterols receptor LXR-beta {Human (Homo sapiens) 99.09
d2p54a1267 Peroxisome proliferator activated receptor alpha, 99.09
d1hg4a_265 Ultraspiracle protein, usp {Drosophila melanogaste 99.09
d2e2ra1223 Orphan nuclear receptor ERR3 {Human (Homo sapiens) 99.08
d1n83a_251 Orphan nuclear receptor ROR-alpha {Human (Homo sap 99.07
d1pk5a_242 Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus 99.06
d2fvja1271 Peroxisome proliferator activated receptor gamma, 99.06
d1fcya_236 Retinoic acid receptor gamma (RAR-gamma) {Human (H 99.05
d1nq7a_244 Orphan nuclear receptor ROR-beta {Rat (Rattus norv 99.03
d1pzla_233 Hepatocyte nuclear factor 4-alpha {Human (Homo sap 99.02
d3d24a1227 Steroid hormone receptor ERR1 {Human (Homo sapiens 99.01
d2b50b1265 Peroxisome proliferator-activated receptor delta, 98.95
d2r40d1243 Ecdysone receptor {Noctuid moth (Heliothis viresce 98.94
d2p1ta1230 Retinoid-X receptor alpha (RXR-alpha) {Human (Homo 98.93
d1ovla_236 Orphan nuclear receptor NURR1 {Human (Homo sapiens 98.9
d1nhza_247 Glucocorticoid receptor {Human (Homo sapiens) [Tax 98.84
d1t7ra_250 Androgen receptor {Chimpanzee (Pan troglodytes) [T 98.83
d1sqna_251 Progesterone receptor {Human (Homo sapiens) [TaxId 98.83
d1pdua_230 Nuclear hormone receptor HR38 {Fruit fly (Drosophi 98.81
d2qw4a1233 Orphan nuclear receptor NR4A1 {Human (Homo sapiens 98.79
d1xpca_245 Estrogen receptor alpha {Human (Homo sapiens) [Tax 98.59
d2j7ya1236 Estrogen receptor beta {Rat (Rattus norvegicus) [T 98.51
>d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: Nuclear receptor ligand-binding domain
superfamily: Nuclear receptor ligand-binding domain
family: Nuclear receptor ligand-binding domain
domain: Orphan nuclear receptor NR5a2 (LRH-1)
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.96  E-value=6.6e-28  Score=190.64  Aligned_cols=152  Identities=32%  Similarity=0.552  Sum_probs=140.5

Q ss_pred             cCCCCHHHHHHhHHHHHHhHhhhh--hhcCCCcchhHHHHHHHHhhHHHHHHHHHHHHhhcCCCCcEEeeCCcccchhhh
Q psy12692         35 RGILNRTHVEEGHEQVQKALLDYC--ITAYPQIQVDDQMKLLQHSWSDMLVLDHMHQRMHNALPDETTLHNGQKFDLLSL  112 (187)
Q Consensus        35 ~~l~~~~~V~~l~~~~l~~Lv~~~--~~~f~~l~~~DQ~~LL~~~w~el~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~  112 (187)
                      ..+.....+|++.++.+..+++|+  .|.|..++.+||++|||++|.|++++++++|+.++..++.+.+.+|...+....
T Consensus        39 ~~~~~~~~l~~~~~~~l~~~V~waK~lp~F~~L~~~DQ~~LLk~~~~el~iL~~a~~s~~~~~~~~~~~~~g~~~~~~~~  118 (242)
T d1pk5a_          39 EKLSAFGLLCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVAHGKEGTIFLVTGEHVDYSTI  118 (242)
T ss_dssp             SCCCSHHHHHHHHHHHHHHHHHHHHHSTTGGGSCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCSSEEECTTSCEEEHHHH
T ss_pred             CcccHHHHHHHHHHHHHHHHHHHHHhCCCHhhcCHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCeeEecCCCcccchHH
Confidence            356778999999999999999999  999999999999999999999999999999999987778899999988876554


Q ss_pred             ---hhcChHHHHHHHHHHHHHHhccCCCc-----------------------------------------------cchH
Q psy12692        113 ---GLLGVPTLRDRFTQVTHKLSELKFPN-----------------------------------------------CDKF  142 (187)
Q Consensus       113 ---~~~~~~~~~~~l~~~~~~l~~L~ld~-----------------------------------------------~~r~  142 (187)
                         ...++.++++.+++++.+|++|++|+                                               +.||
T Consensus       119 ~~~~~~~~~~~~~~~~~l~~~l~~L~ld~~E~~lLkai~Lf~pd~~gL~~~~~v~~~q~~~~~aL~~y~~~~~~~~~~Rf  198 (242)
T d1pk5a_         119 ISHTEVAFNNLLSLAQELVVRLRSLQFDQREFVCLKFLVLFSSDVKNLENLQLVEGVQEQVNAALLDYTVCNYPQQTEKF  198 (242)
T ss_dssp             HHTSCHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHSCSCCSSCTTHHHHHHHHHHHHHHHHHHHHHHCTTSTTHH
T ss_pred             hhhcccchHHHHHHHHHHHHHHHHhCCCHHHHHHHHHHHhcCCCCCCchhHHHHHHHHHHHHHHHHHHHHhhCCCcchHH
Confidence               33456678889999999999999999                                               8999


Q ss_pred             HHHHHhChhhHhhhHHHHHHHHHHhhcCCCChhhHHHHHHhcCC
Q psy12692        143 GKLMSILPELHEIASRGEEHLYHKHCNGGAPTQTLLMEMLHAKR  186 (187)
Q Consensus       143 ~~Lll~lp~lr~ls~~~~e~l~~~~~~g~~~~~~ll~eml~~~~  186 (187)
                      ++|++.+|++|+++...+|+++|+++.|.+|+++|+.|||+++|
T Consensus       199 ~~LLl~Lp~Lr~~~~~~~e~L~~~~~~g~~~~~~Ll~Eml~~~r  242 (242)
T d1pk5a_         199 GQLLLRLPELRAISKQAEDYLYYKHVNGDVPYNNLLIEMLHAKR  242 (242)
T ss_dssp             HHHHTTHHHHHHHHHHHHHHHHHHHHTTCSCCCHHHHHHHTTTC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhcCCCCCCChHHHHHHHHhCCC
Confidence            99999999999999999999999999999999999999999987



>d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} Back     information, alignment and structure
>d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} Back     information, alignment and structure
>d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} Back     information, alignment and structure
>d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} Back     information, alignment and structure
>d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} Back     information, alignment and structure
>d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} Back     information, alignment and structure
>d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure