Psyllid ID: psy12696

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------
MSTSYLEQYLDSLDSLPIELQRNFTLMRELDSRAQDVMKTIDRVAEDYLDNMKHYSKDKKKETLAEIQKYFDKTKEYGDDKVQLAIQTYEMVDKYIRKLDTDLARFEQEIQEKALKNTTGGAGGGGSGTGSGSGSAGGAASKSKRGRKKAKDKAESATDAAGDDKSSNSKKKVAKKITGVGGVVGVLNAIVAADPDVAAPSHDVLDMPVDPNEPTYCVCQQVSYGEMIGCDNPDCPIEWFHFACVSLTTKPKGKWYCPKCTSDRKKK
ccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccc
ccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccEcccEEEcccccccEEEEEEcEccccccccccEcccccccccccc
MSTSYLEQYLDSLDSLPIELQRNFTLMRELDSRAQDVMKTIDRVAEDYLDNMKHYSKDKKKETLAEIQKYFDKtkeygddkVQLAIQTYEMVDKYIRKLDTDLARFEQEIQEKALknttggaggggsgtgsgsgsaggaaskskrgrkKAKDKaesatdaagddkssnskKKVAKKITGVGGVVGVLNAIVaadpdvaapshdvldmpvdpneptycvcqqvsygemigcdnpdcpiewFHFACvslttkpkgkwycpkctsdrkkk
MSTSYLEQYLDSLDSLPIELQRNFTLMRELDSRAQDVMKTIDRVAEDYLDNmkhyskdkkketLAEIQKYfdktkeygddkVQLAIQTYEMVDKYIRKLDTDLARFEQEIQEKAlknttggaggggsgtgsgsgsaggaaskskrgrkkakdkaesatdaagddkssnskkkvakkitgvggvVGVLNAIVAADPDVAAPSHDVLDMPVDPNEPTYCVCQQVSYGEMIGCDNPDCPIEWFHFACVSlttkpkgkwycpkctsdrkkk
MSTSYLEQYLDSLDSLPIELQRNFTLMRELDSRAQDVMKTIDRVAEDYLDNMKHYSKDKKKETLAEIQKYFDKTKEYGDDKVQLAIQTYEMVDKYIRKLDTDLARFEQEIQEKALKNTtggaggggsgtgsgsgsaggaaskskrgrkkakdkaESATdaagddkssnskkkvakkitgvggvvgvlnaivaadpdvaapSHDVLDMPVDPNEPTYCVCQQVSYGEMIGCDNPDCPIEWFHFACVSLTTKPKGKWYCPKCTSDRKKK
********YLDSLDSLPIELQRNFTLMRELD***QDVMKTIDRVAEDYLDNM***********LAEIQKYFDKTKEYGDDKVQLAIQTYEMVDKYIRKLDTDLARF*********************************************************************KITGVGGVVGVLNAIVAADPDVAAPSHDVLDMPVDPNEPTYCVCQQVSYGEMIGCDNPDCPIEWFHFACVSLTTKPKGKWYCPKC*******
MSTSYLEQYLDSLDSLPIELQRNFTLMRELDSRAQDVMKTIDRVA********************************GDDKVQLAIQTYEMVDKYIRKLDTDLARFEQ**********************************************************SNSKKKV*************************************PNEPTYCVCQQVSYGEMIGCDNPDCPIEWFHFACVSLTTKPKGKWYCPKCTSD****
MSTSYLEQYLDSLDSLPIELQRNFTLMRELDSRAQDVMKTIDRVAEDYLDNMKHYSKDKKKETLAEIQKYFDKTKEYGDDKVQLAIQTYEMVDKYIRKLDTDLARFEQEIQEKALKNT********************************************************KKITGVGGVVGVLNAIVAADPDVAAPSHDVLDMPVDPNEPTYCVCQQVSYGEMIGCDNPDCPIEWFHFACVSLTTKPKGKWYCP*********
MSTSYLEQYLDSLDSLPIELQRNFTLMRELDSRAQDVMKTIDRVAEDYLDNMKHYSKDKKKETLAEIQKYFDKTKEYGDDKVQLAIQTYEMVDKYIRKLDTDLARFEQEIQE*******************************************************************************************VLDMPVDPNEPTYCVCQQVSYGEMIGCDNPDCPIEWFHFACVSLTTKPKGKWYCPKCT******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTSYLEQYLDSLDSLPIELQRNFTLMRELDSRAQDVMKTIDRVAEDYLDNMKHYSKDKKKETLAEIQKYFDKTKEYGDDKVQLAIQTYEMVDKYxxxxxxxxxxxxxxxxxxxxxNTTGGAGGGGSGTGSGSGSAGGAASKSKRGRKKAKDKAESATDAAGDDKSSNSKKKVAKKITGVGGVVGVLNAIVAADPDVAAPSHDVLDMPVDPNEPTYCVCQQVSYGEMIGCDNPDCPIEWFHFACVSLTTKPKGKWYCPKCTSDRKKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query267 2.2.26 [Sep-21-2011]
Q5ZKY4249 Inhibitor of growth prote yes N/A 0.913 0.979 0.509 3e-71
Q8C0D7249 Inhibitor of growth prote yes N/A 0.913 0.979 0.509 7e-71
Q9UNL4249 Inhibitor of growth prote yes N/A 0.913 0.979 0.501 1e-70
Q9D8Y8240 Inhibitor of growth prote no N/A 0.891 0.991 0.492 2e-69
Q8WYH8240 Inhibitor of growth prote no N/A 0.891 0.991 0.507 5e-68
Q3T095248 Inhibitor of growth prote no N/A 0.910 0.979 0.501 4e-67
Q9QXV3279 Inhibitor of growth prote no N/A 0.928 0.888 0.387 1e-49
Q9ESK4281 Inhibitor of growth prote no N/A 0.906 0.861 0.330 3e-40
Q9H160280 Inhibitor of growth prote no N/A 0.906 0.864 0.338 8e-40
Q9UK53422 Inhibitor of growth prote no N/A 0.812 0.514 0.360 2e-36
>sp|Q5ZKY4|ING4_CHICK Inhibitor of growth protein 4 OS=Gallus gallus GN=ING4 PE=2 SV=1 Back     alignment and function desciption
 Score =  268 bits (685), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 134/263 (50%), Positives = 175/263 (66%), Gaps = 19/263 (7%)

Query: 5   YLEQYLDSLDSLPIELQRNFTLMRELDSRAQDVMKTIDRVAEDYLDNMKHYSKDKKKETL 64
           YLE YLDS+++LP ELQRNF LMR+LD R +D+   ID++A +Y+ N +  S ++K   L
Sbjct: 6   YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKSEIDKLATEYISNARTLSSEEKLGLL 65

Query: 65  AEIQKYFDKTKEYGDDKVQLAIQTYEMVDKYIRKLDTDLARFEQEIQEKALKNTTGGAGG 124
            +IQ+ + K KE+GDDKVQLA+QTYEMVDK+IR+LDTDLARFE +++EK ++++   +  
Sbjct: 66  KQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSS 125

Query: 125 GGSGTGSGSGSAGGAASKSKRGRKKAKDKAESATDAAGDDKSSNSKKKVAKKITGVGGVV 184
                   +     AA    R R K K+  E A       K++  K K+ +  T  G   
Sbjct: 126 SKGKKKGRAQKEKKAA----RARSKGKNSDEEAP------KTAQKKLKLVRTSTEYGMPS 175

Query: 185 GVLNAIVAADPDVAAPSHDVLDMPVDPNEPTYCVCQQVSYGEMIGCDNPDCPIEWFHFAC 244
                +         PS DVLDMPVDPNEPTYC+C QVSYGEMIGCDNPDC IEWFHFAC
Sbjct: 176 VTFGNV--------HPS-DVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFAC 226

Query: 245 VSLTTKPKGKWYCPKCTSDRKKK 267
           V LTTKP+GKW+CP+C+ +RKKK
Sbjct: 227 VGLTTKPRGKWFCPRCSQERKKK 249
Through chromatin acetylation it may function in DNA replication. May inhibit tumor progression by modulating the transcriptional output of signaling pathways which regulate cell proliferation.
Gallus gallus (taxid: 9031)
>sp|Q8C0D7|ING4_MOUSE Inhibitor of growth protein 4 OS=Mus musculus GN=Ing4 PE=1 SV=2 Back     alignment and function description
>sp|Q9UNL4|ING4_HUMAN Inhibitor of growth protein 4 OS=Homo sapiens GN=ING4 PE=1 SV=1 Back     alignment and function description
>sp|Q9D8Y8|ING5_MOUSE Inhibitor of growth protein 5 OS=Mus musculus GN=Ing5 PE=1 SV=1 Back     alignment and function description
>sp|Q8WYH8|ING5_HUMAN Inhibitor of growth protein 5 OS=Homo sapiens GN=ING5 PE=1 SV=1 Back     alignment and function description
>sp|Q3T095|ING4_BOVIN Inhibitor of growth protein 4 OS=Bos taurus GN=ING4 PE=2 SV=1 Back     alignment and function description
>sp|Q9QXV3|ING1_MOUSE Inhibitor of growth protein 1 OS=Mus musculus GN=Ing1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ESK4|ING2_MOUSE Inhibitor of growth protein 2 OS=Mus musculus GN=Ing2 PE=1 SV=3 Back     alignment and function description
>sp|Q9H160|ING2_HUMAN Inhibitor of growth protein 2 OS=Homo sapiens GN=ING2 PE=1 SV=2 Back     alignment and function description
>sp|Q9UK53|ING1_HUMAN Inhibitor of growth protein 1 OS=Homo sapiens GN=ING1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query267
350535360279 uncharacterized protein LOC100161116 [Ac 0.996 0.953 0.548 1e-82
189237225269 PREDICTED: similar to AGAP009992-PA [Tri 0.966 0.959 0.567 1e-81
291224580257 PREDICTED: inhibitor of growth family, m 0.951 0.988 0.562 2e-81
270007167278 hypothetical protein TcasGA2_TC013703 [T 0.966 0.928 0.559 5e-81
307171077260 Inhibitor of growth protein 4 [Camponotu 0.970 0.996 0.582 1e-80
340729685252 PREDICTED: inhibitor of growth protein 5 0.917 0.972 0.596 3e-79
328698023279 PREDICTED: inhibitor of growth protein 4 0.962 0.921 0.520 4e-79
242016091259 Inhibitor of growth protein, putative [P 0.917 0.945 0.564 8e-79
383859248255 PREDICTED: inhibitor of growth protein 5 0.932 0.976 0.593 8e-79
328697570279 PREDICTED: inhibitor of growth protein 4 0.962 0.921 0.520 1e-78
>gi|350535360|ref|NP_001233000.1| uncharacterized protein LOC100161116 [Acyrthosiphon pisum] gi|239789913|dbj|BAH71552.1| ACYPI002366 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 152/277 (54%), Positives = 190/277 (68%), Gaps = 11/277 (3%)

Query: 2   STSYLEQYLDSLDSLPIELQRNFTLMRELDSRAQDVMKTIDRVAEDYLDNMKHYSKDKKK 61
           S  YLE YLDSL++LP+ELQRNFTLMR+LDSRAQ++M+ ID++A+DY+ N+K Y+ +KK 
Sbjct: 3   SALYLEHYLDSLENLPVELQRNFTLMRDLDSRAQELMRNIDKLADDYMSNVKGYTVEKKN 62

Query: 62  ETLAEIQKYFDKTKEYGDDKVQLAIQTYEMVDKYIRKLDTDLARFEQEIQEKAL---KNT 118
           ET+  IQ+ FDK KEYGDDKVQLAIQTYE+VDK+IRKLD+DLARFE EIQ+KA+   +N 
Sbjct: 63  ETMTSIQRQFDKAKEYGDDKVQLAIQTYELVDKHIRKLDSDLARFEAEIQDKAISATRNI 122

Query: 119 TGGAGGGGSGTGSGSGSAGGAASKSKRGRKKAKDKAESATDAAGDDKSSNSKKKVAKKIT 178
             G+   G            +AS  +    K   K +     A    ++ SK  +   +T
Sbjct: 123 EEGSQKRGRKKTKDKEVKKKSASSEEETVTKTSKKKQLKKVGAKSTSAAPSKTPLVSVVT 182

Query: 179 GVGGVVGVLNAIVAADPDV--------AAPSHDVLDMPVDPNEPTYCVCQQVSYGEMIGC 230
                   + ++ A    +         A S +VLDMPVDPNEPTYC+C QVSYGEMIGC
Sbjct: 183 NPTNPTNSVASVTAETSSLTGALVGAGVAHSAEVLDMPVDPNEPTYCLCNQVSYGEMIGC 242

Query: 231 DNPDCPIEWFHFACVSLTTKPKGKWYCPKCTSDRKKK 267
           DNPDCPIEWFHFACV LTTKPKGKW+CPKC +DRKKK
Sbjct: 243 DNPDCPIEWFHFACVKLTTKPKGKWFCPKCITDRKKK 279

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189237225|ref|XP_001810464.1| PREDICTED: similar to AGAP009992-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|291224580|ref|XP_002732281.1| PREDICTED: inhibitor of growth family, member 4-like isoform 1 [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|270007167|gb|EFA03615.1| hypothetical protein TcasGA2_TC013703 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307171077|gb|EFN63120.1| Inhibitor of growth protein 4 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340729685|ref|XP_003403127.1| PREDICTED: inhibitor of growth protein 5-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|328698023|ref|XP_001943164.2| PREDICTED: inhibitor of growth protein 4-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242016091|ref|XP_002428669.1| Inhibitor of growth protein, putative [Pediculus humanus corporis] gi|212513340|gb|EEB15931.1| Inhibitor of growth protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|383859248|ref|XP_003705107.1| PREDICTED: inhibitor of growth protein 5-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|328697570|ref|XP_001948924.2| PREDICTED: inhibitor of growth protein 4-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query267
ZFIN|ZDB-GENE-031016-1242 ing5a "inhibitor of growth fam 0.243 0.268 0.907 6.8e-69
FB|FBgn0032516285 CG9293 [Drosophila melanogaste 0.243 0.228 0.907 1.2e-67
UNIPROTKB|Q5ZKY4249 ING4 "Inhibitor of growth prot 0.426 0.457 0.561 1.1e-66
UNIPROTKB|F1MD09248 ING4 "Inhibitor of growth prot 0.243 0.262 0.846 2.9e-66
UNIPROTKB|E2RNT1249 ING4 "Uncharacterized protein" 0.243 0.261 0.846 2.9e-66
UNIPROTKB|Q9UNL4249 ING4 "Inhibitor of growth prot 0.243 0.261 0.846 2.9e-66
MGI|MGI:107307249 Ing4 "inhibitor of growth fami 0.243 0.261 0.846 2.9e-66
RGD|1309407249 Ing4 "inhibitor of growth fami 0.243 0.261 0.846 2.9e-66
UNIPROTKB|Q5ZJ84241 ING5 "Uncharacterized protein" 0.239 0.265 0.859 3.7e-66
UNIPROTKB|E2RJ78240 ING5 "Uncharacterized protein" 0.243 0.270 0.861 6.1e-66
ZFIN|ZDB-GENE-031016-1 ing5a "inhibitor of growth family, member 5a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 365 (133.5 bits), Expect = 6.8e-69, Sum P(2) = 6.8e-69
 Identities = 59/65 (90%), Positives = 62/65 (95%)

Query:   203 DVLDMPVDPNEPTYCVCQQVSYGEMIGCDNPDCPIEWFHFACVSLTTKPKGKWYCPKCTS 262
             DVLDMPVDPNEPTYC+C QVSYGEMIGCDNPDCPIEWFHFACV LTTKPKGKW+CP+CT 
Sbjct:   178 DVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCTQ 237

Query:   263 DRKKK 267
             DRKKK
Sbjct:   238 DRKKK 242
GO:0008270 "zinc ion binding" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
FB|FBgn0032516 CG9293 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKY4 ING4 "Inhibitor of growth protein 4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MD09 ING4 "Inhibitor of growth protein 4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RNT1 ING4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UNL4 ING4 "Inhibitor of growth protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:107307 Ing4 "inhibitor of growth family, member 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309407 Ing4 "inhibitor of growth family, member 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJ84 ING5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RJ78 ING5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8WYH8ING5_HUMANNo assigned EC number0.50740.89130.9916noN/A
Q6CXN0YNG2_KLULANo assigned EC number0.28140.95880.8677yesN/A
O42871ING1_SCHPONo assigned EC number0.28410.96250.9081yesN/A
Q6C5V7YNG2_YARLINo assigned EC number0.26190.97370.9187yesN/A
Q9UNL4ING4_HUMANNo assigned EC number0.50190.91380.9799yesN/A
Q9LIQ6ING1_ARATHNo assigned EC number0.27830.82770.9444yesN/A
Q5ZKY4ING4_CHICKNo assigned EC number0.50950.91380.9799yesN/A
Q8C0D7ING4_MOUSENo assigned EC number0.50950.91380.9799yesN/A
Q3T095ING4_BOVINNo assigned EC number0.50190.91010.9798noN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query267
pfam12998104 pfam12998, ING, Inhibitor of growth proteins N-ter 1e-40
COG5034271 COG5034, TNG2, Chromatin remodeling protein, conta 1e-37
pfam0062851 pfam00628, PHD, PHD-finger 4e-11
smart0024947 smart00249, PHD, PHD zinc finger 1e-08
>gnl|CDD|221887 pfam12998, ING, Inhibitor of growth proteins N-terminal histone-binding Back     alignment and domain information 
 Score =  135 bits (342), Expect = 1e-40
 Identities = 48/104 (46%), Positives = 71/104 (68%), Gaps = 1/104 (0%)

Query: 4   SYLEQYLDSLDSLPIELQRNFTLMRELDSRAQDVMKTIDRVAEDYLDNMK-HYSKDKKKE 62
            YLE YLD L++LP+ELQRNFT +RE+D++ Q ++K +D   + ++     + S  K++E
Sbjct: 1   LYLEDYLDDLENLPLELQRNFTEIREIDAQVQKIIKELDEQIQKFIKENGSNLSNPKEEE 60

Query: 63  TLAEIQKYFDKTKEYGDDKVQLAIQTYEMVDKYIRKLDTDLARF 106
            L  IQ+   K +E  D+KVQLA Q YE+VDK+IR+LD DL + 
Sbjct: 61  LLKRIQEELIKAQELQDEKVQLANQAYELVDKHIRRLDKDLEKL 104

Histones undergo numerous post-translational modifications, including acetylation and methylation, at residues which are then probable docking sites for various chromatin remodelling complexes. Inhibitor of growth proteins (INGs) specifically bind to residues that have been thus modified. INGs carry a well-characterized C-terminal PHD-type zinc-finger domain, binding with lysine 4-tri-methylated histone H3 (H3K4me3), as well as this N-terminal domain that binds unmodified H3 tails. Although these two regions can bind histones independently, together they increase the apparent association of the ING for the H3 tail. Length = 104
>gnl|CDD|227367 COG5034, TNG2, Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 267
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 100.0
KOG1973|consensus274 100.0
PF12998105 ING: Inhibitor of growth proteins N-terminal histo 99.95
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.81
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.66
KOG1512|consensus381 97.93
KOG4323|consensus 464 97.91
KOG0954|consensus 893 97.77
KOG0825|consensus 1134 97.66
KOG4299|consensus 613 97.66
KOG1244|consensus336 97.56
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 97.45
KOG1245|consensus 1404 96.95
KOG0955|consensus 1051 96.92
KOG0383|consensus 696 96.74
KOG0956|consensus 900 96.61
COG5141 669 PHD zinc finger-containing protein [General functi 96.34
KOG1632|consensus 345 96.11
KOG0957|consensus 707 95.66
KOG0957|consensus 707 94.42
KOG1632|consensus345 93.41
KOG2752|consensus 345 91.41
KOG1844|consensus 508 91.17
KOG4443|consensus 694 88.57
COG1382119 GimC Prefoldin, chaperonin cofactor [Posttranslati 86.83
PF07227 446 DUF1423: Protein of unknown function (DUF1423); In 85.74
PF10158131 LOH1CR12: Tumour suppressor protein; InterPro: IPR 82.1
PF1334178 RAG2_PHD: RAG2 PHD domain; PDB: 2JWO_A 2V86_B 2V85 81.34
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 81.27
PF1079687 Anti-adapt_IraP: Sigma-S stabilisation anti-adapto 81.14
PF1377190 zf-HC5HC2H: PHD-like zinc-binding domain 81.02
KOG1493|consensus84 80.94
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 80.93
TIGR02338110 gimC_beta prefoldin, beta subunit, archaeal. Chape 80.49
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information 
Probab=100.00  E-value=4.8e-39  Score=277.89  Aligned_cols=256  Identities=26%  Similarity=0.436  Sum_probs=157.4

Q ss_pred             hhHHHHHHHHhhcchHHHHHhHHHHHHHHHHHHHHHHHHHHH--HHHHHHhcCCCChhHHH-HHHHHHHHHHHHHHHhHH
Q psy12696          3 TSYLEQYLDSLDSLPIELQRNFTLMRELDSRAQDVMKTIDRV--AEDYLDNMKHYSKDKKK-ETLAEIQKYFDKTKEYGD   79 (267)
Q Consensus         3 ~~yLedfld~ie~LP~El~r~l~~irelD~~~~~~~~~i~~~--~~~~~k~~~~~~~~~~~-~~~~~I~~~~~~~~~lsd   79 (267)
                      ...|+||+|.|+|+|.|+.+.|++|.++|.++.++++.+.+.  +.+|+.+.++++++++. .+...|++.|-.+..+..
T Consensus         4 ~~~Lnd~~d~l~n~P~et~~~~t~l~~iD~k~~d~~k~l~q~~si~k~~~~~~~~t~~e~ed~l~k~i~Ell~~a~~~~~   83 (271)
T COG5034           4 FPGLNDITDHLANVPSETDIRFTELSEIDAKVCDIIKNLRQMISILKKIIDLDSQTYEEVEDGLLKEIRELLLKAIYIQK   83 (271)
T ss_pred             hHHHHHHHHHHHhCChhhhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHhhcccCccccchhHHHHHHHHHHHHHHHHHH
Confidence            457999999999999999999999999999999999998765  55777788888888877 455789999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHhhcCCC---CCCCCCCCCCCCCCCCCCCCC-cccccccccc--c
Q psy12696         80 DKVQLAIQTYEMVDKYIRKLDTDLARFEQEIQE-KALKNTTG---GAGGGGSGTGSGSGSAGGAAS-KSKRGRKKAK--D  152 (267)
Q Consensus        80 EKv~LA~~a~dlVd~hirrLD~dl~~~e~el~~-~~~~~~~~---~~~~~~~~~~~~s~~~~~~~~-~~~~~r~~~~--~  152 (267)
                      +|..|++.+.-+++||+++||..+.+...+... .+++....   ...++.+..  ...+++...+ .+.-|+++++  .
T Consensus        84 ~~~~l~d~~~~l~~Rh~~~~d~~~a~~~h~~~~~~ie~~~~~~s~~~~~~~ss~--a~~ss~~~~saassqgs~~t~~~~  161 (271)
T COG5034          84 EKSDLADRAEKLLRRHRKLLDDRIAKRPHEKVAARIENCHDAVSRLERNSYSSA--ARRSSGEHRSAASSQGSRHTKLKK  161 (271)
T ss_pred             HHHHHHHHHHHHHHHHHHhhhhHHHhhhhhhhhhhhhhhhhhhhhhhccccchh--hhccccccccccccccccCchhHH
Confidence            999999999999999999999998776654433 22222100   000111100  0000000000 0000111111  0


Q ss_pred             ccccccccCCCCCCCchhhhhccccCCCCCccccccccccCCC-CCCCCCCCCCCCCCCCCCCceeecCCCCCCCccccc
Q psy12696        153 KAESATDAAGDDKSSNSKKKVAKKITGVGGVVGVLNAIVAADP-DVAAPSHDVLDMPVDPNEPTYCVCQQVSYGEMIGCD  231 (267)
Q Consensus       153 ~~~~~~~~~~~~~~~~~kk~~~~~~~~~~~~~g~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~C~C~~~~~~~mi~Cd  231 (267)
                      +.........++ ...+++.+....  .++..+.......... ....+.-.+......+++++||+|++++||+||+||
T Consensus       162 R~n~~~~k~~~p-~~~S~r~~~~t~--~sp~v~~t~t~v~e~~~~~s~~~~~vss~d~se~e~lYCfCqqvSyGqMVaCD  238 (271)
T COG5034         162 RKNIHNLKRRSP-ELSSKREVSFTL--ESPSVPDTATRVKEGNNGGSTKSRGVSSEDNSEGEELYCFCQQVSYGQMVACD  238 (271)
T ss_pred             HHhhcccccCCc-chhhhccCCccC--CCCCcccchhhhhcccCCCCccccCcCccccccCceeEEEecccccccceecC
Confidence            110000000011 000111111100  0010000000000000 000011111112234678999999999999999999


Q ss_pred             CCCCCCcceecccCccCCCCCCceeCcCCcCc
Q psy12696        232 NPDCPIEWFHFACVSLTTKPKGKWYCPKCTSD  263 (267)
Q Consensus       232 ~~~c~~~wfH~~Cv~l~~~p~~~w~C~~C~~~  263 (267)
                      +.+|+++|||+.||||..+|+|+|||+.|...
T Consensus       239 n~nCkrEWFH~~CVGLk~pPKG~WYC~eCk~~  270 (271)
T COG5034         239 NANCKREWFHLECVGLKEPPKGKWYCPECKKA  270 (271)
T ss_pred             CCCCchhheeccccccCCCCCCcEeCHHhHhc
Confidence            99999999999999999999999999999753

>KOG1973|consensus Back     alignment and domain information
>PF12998 ING: Inhibitor of growth proteins N-terminal histone-binding; InterPro: IPR024610 Histones undergo numerous post-translational modifications, including acetylation and methylation, at residues which are then probable docking sites for various chromatin remodelling complexes Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1512|consensus Back     alignment and domain information
>KOG4323|consensus Back     alignment and domain information
>KOG0954|consensus Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG4299|consensus Back     alignment and domain information
>KOG1244|consensus Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG1245|consensus Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>KOG0956|consensus Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG1632|consensus Back     alignment and domain information
>KOG0957|consensus Back     alignment and domain information
>KOG0957|consensus Back     alignment and domain information
>KOG1632|consensus Back     alignment and domain information
>KOG2752|consensus Back     alignment and domain information
>KOG1844|consensus Back     alignment and domain information
>KOG4443|consensus Back     alignment and domain information
>COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] Back     alignment and domain information
>PF10158 LOH1CR12: Tumour suppressor protein; InterPro: IPR018780 This entry represents a region of 130 amino acids that is the most conserved part of some hypothetical proteins involved in loss of heterozygosity, and thus, tumour suppression [] Back     alignment and domain information
>PF13341 RAG2_PHD: RAG2 PHD domain; PDB: 2JWO_A 2V86_B 2V85_B 2V87_A 2V83_C 2V89_A 2V88_A Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>PF10796 Anti-adapt_IraP: Sigma-S stabilisation anti-adaptor protein ; InterPro: IPR019732 This entry is conserved in Enterobacteriaceae Back     alignment and domain information
>PF13771 zf-HC5HC2H: PHD-like zinc-binding domain Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query267
1wen_A71 Solution Structure Of Phd Domain In Ing1-Like Prote 4e-30
2k1j_A63 Plan Homeodomain Finger Of Tumour Supressor Ing4 Le 6e-30
1weu_A91 Solution Structure Of Phd Domain In Ing1-Like Prote 2e-29
2m1r_A63 Phd Domain Of Ing4 N214d Mutant Length = 63 3e-29
2vnf_A60 Molecular Basis Of Histone H3k4me3 Recognition By I 2e-28
1wes_A71 Solution Structure Of Phd Domain In Inhibitor Of Gr 3e-27
2qic_A62 Crystal Structure Of The Ing1 Phd Finger In Complex 2e-26
4afl_A104 The Crystal Structure Of The Ing4 Dimerization Doma 5e-26
2pnx_A55 The Phd Finger Of Ing4 In Complex With An H3k4me3 H 7e-26
2g6q_A62 Crystal Structure Of Ing2 Phd Domain In Complex Wit 5e-25
3c6w_A59 Crystal Structure Of The Ing5 Phd Finger In Complex 2e-24
1x4i_A70 Solution Structure Of Phd Domain In Inhibitor Of Gr 5e-23
2jmi_A90 Nmr Solution Structure Of Phd Finger Fragment Of Ye 1e-15
2k16_A75 Solution Structure Of The Free Taf3 Phd Domain Leng 3e-04
>pdb|1WEN|A Chain A, Solution Structure Of Phd Domain In Ing1-Like Protein Bac25079 Length = 71 Back     alignment and structure 
Iteration: 1

 Score =  128 bits (321), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 48/58 (82%), Positives = 54/58 (93%)
Query: 206 DMPVDPNEPTYCVCQQVSYGEMIGCDNPDCPIEWFHFACVSLTTKPKGKWYCPKCTSD 263
           DMPVDPNEPTYC+C QVSYGEMIGCDNPDC IEWFHFACV LTTKP+GKW+CP+C+ +
Sbjct: 8   DMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQE 65
>pdb|2K1J|A Chain A, Plan Homeodomain Finger Of Tumour Supressor Ing4 Length = 63 Back     alignment and structure
>pdb|1WEU|A Chain A, Solution Structure Of Phd Domain In Ing1-Like Protein Bac25009 Length = 91 Back     alignment and structure
>pdb|2M1R|A Chain A, Phd Domain Of Ing4 N214d Mutant Length = 63 Back     alignment and structure
>pdb|2VNF|A Chain A, Molecular Basis Of Histone H3k4me3 Recognition By Ing4 Length = 60 Back     alignment and structure
>pdb|1WES|A Chain A, Solution Structure Of Phd Domain In Inhibitor Of Growth Family, Member 1-Like Length = 71 Back     alignment and structure
>pdb|2QIC|A Chain A, Crystal Structure Of The Ing1 Phd Finger In Complex With A Histone H3k4me3 Peptide Length = 62 Back     alignment and structure
>pdb|4AFL|A Chain A, The Crystal Structure Of The Ing4 Dimerization Domain Reveals The Functional Organization Of The Ing Family Of Chromatin Binding Proteins. Length = 104 Back     alignment and structure
>pdb|2PNX|A Chain A, The Phd Finger Of Ing4 In Complex With An H3k4me3 Histone Peptide Length = 55 Back     alignment and structure
>pdb|2G6Q|A Chain A, Crystal Structure Of Ing2 Phd Domain In Complex With H3k4me3 Peptide Length = 62 Back     alignment and structure
>pdb|3C6W|A Chain A, Crystal Structure Of The Ing5 Phd Finger In Complex With H3k4me3 Peptide Length = 59 Back     alignment and structure
>pdb|1X4I|A Chain A, Solution Structure Of Phd Domain In Inhibitor Of Growth Protein 3 (Ing3) Length = 70 Back     alignment and structure
>pdb|2JMI|A Chain A, Nmr Solution Structure Of Phd Finger Fragment Of Yeast Yng1 Protein In Free State Length = 90 Back     alignment and structure
>pdb|2K16|A Chain A, Solution Structure Of The Free Taf3 Phd Domain Length = 75 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query267
4afl_A104 P29ING4, inhibitor of growth protein 4; cell cycle 99.97
1weu_A91 Inhibitor of growth family, member 4; structural g 99.89
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 99.88
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 99.86
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 99.83
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 99.83
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 99.82
1x4i_A70 Inhibitor of growth protein 3; structural genomics 99.82
1wew_A78 DNA-binding family protein; structural genomics, P 99.69
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 99.52
3o70_A68 PHD finger protein 13; PHF13, structural genomics 99.51
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 99.47
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.45
1we9_A64 PHD finger family protein; structural genomics, PH 99.44
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 99.43
1wem_A76 Death associated transcription factor 1; structura 99.43
1wee_A72 PHD finger family protein; structural genomics, PH 99.41
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 99.37
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 99.26
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.22
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 99.2
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.18
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.17
2ri7_A 174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.15
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 99.14
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 99.14
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.13
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.12
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.11
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.1
3kv5_D 488 JMJC domain-containing histone demethylation prote 99.08
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.08
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.07
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.04
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.03
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.94
2yt5_A66 Metal-response element-binding transcription facto 98.93
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.89
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.84
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.75
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.66
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.66
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.57
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 98.53
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.51
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.3
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.04
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 97.93
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 97.92
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 97.76
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 97.73
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 97.11
2xzr_A114 Immunoglobulin-binding protein EIBD; cell adhesion 95.31
1wil_A89 KIAA1045 protein; ring finger domain, structural g 95.08
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 94.34
2pv0_B 386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 94.06
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 90.43
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 88.69
2lq6_A87 Bromodomain-containing protein 1; PHD finger, meta 87.37
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 86.96
1m1j_C 409 Fibrinogen gamma chain; coiled coils, disulfide ri 86.9
2ysl_A73 Tripartite motif-containing protein 31; ring-type 83.13
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 82.71
>4afl_A P29ING4, inhibitor of growth protein 4; cell cycle, tumour suppressor, chromatin remodelling; 2.28A {Homo sapiens} Back     alignment and structure
Probab=99.97  E-value=2.3e-30  Score=200.31  Aligned_cols=103  Identities=56%  Similarity=0.911  Sum_probs=100.0

Q ss_pred             hhhHHHHHHHHhhcchHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCChhHHHHHHHHHHHHHHHHHHhHHHH
Q psy12696          2 STSYLEQYLDSLDSLPIELQRNFTLMRELDSRAQDVMKTIDRVAEDYLDNMKHYSKDKKKETLAEIQKYFDKTKEYGDDK   81 (267)
Q Consensus         2 ~~~yLedfld~ie~LP~El~r~l~~irelD~~~~~~~~~i~~~~~~~~k~~~~~~~~~~~~~~~~I~~~~~~~~~lsdEK   81 (267)
                      +++|||+|+++|+|||.||+|+|++||+||.++++++.++++.+++|+++.++++++++...+.+|++.|.++++++|||
T Consensus         2 ~~~yledyld~ie~LP~El~r~~~~irelD~~~~~~~~~i~~~~~~~~~~~~~~~~~~r~~~l~~I~~~~~~~~~l~dEK   81 (104)
T 4afl_A            2 AGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQEAYGKCKEFGDDK   81 (104)
T ss_dssp             CCHHHHHHHHSGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCSCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCChhhhHHHHHHHHHHHHHHHHHHHHH
Confidence            67999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q psy12696         82 VQLAIQTYEMVDKYIRKLDTDLA  104 (267)
Q Consensus        82 v~LA~~a~dlVd~hirrLD~dl~  104 (267)
                      |+||++||++||+|++|||.||+
T Consensus        82 v~lA~~~~dlvdkhirrLD~dla  104 (104)
T 4afl_A           82 VQLAMQTYEMVDKHIRRLDTDLA  104 (104)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHC-
T ss_pred             HHHHHHHHHHHHHHHHHHhhhcC
Confidence            99999999999999999999874
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2xzr_A Immunoglobulin-binding protein EIBD; cell adhesion, trimeric autotransporter adhesin, TAA; 2.80A {Enterobacteria phage p-eibd} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 267
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 6e-26
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 3e-25
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 5e-19
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 5e-14
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 2e-12
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 3e-12
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 1e-11
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 1e-09
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 4e-08
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 6e-07
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 1e-05
d1dd5a_184 d.67.3.1 (A:) Ribosome recycling factor, RRF {Ther 0.004
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: PHD Inhibitor of growth protein 2, Ing2
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 95.0 bits (236), Expect = 6e-26
 Identities = 46/62 (74%), Positives = 50/62 (80%)

Query: 206 DMPVDPNEPTYCVCQQVSYGEMIGCDNPDCPIEWFHFACVSLTTKPKGKWYCPKCTSDRK 265
           +  +DPNEPTYC+C QVSYGEMIGCDN  CPIEWFHF+CVSLT KPKGKWYCPKC  D  
Sbjct: 8   EFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDSG 67

Query: 266 KK 267
             
Sbjct: 68  PS 69
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1dd5a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Thermotoga maritima [TaxId: 2336]} Length = 184 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query267
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 99.76
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 99.72
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 99.33
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 99.31
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.19
d1wema_76 Death associated transcription factor 1, Datf1 (DI 99.14
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 99.06
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 99.04
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.98
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.93
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.86
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 92.62
d2v89a174 V(D)J recombination-activating protein 2, Rag2 {Mo 89.44
d1gs9a_144 Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 85.47
d1weqa_85 PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculu 82.98
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 80.24
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: PHD Inhibitor of growth protein 2, Ing2
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.76  E-value=2.9e-19  Score=126.63  Aligned_cols=61  Identities=75%  Similarity=1.629  Sum_probs=55.0

Q ss_pred             CCCCCCCCCceeecCCCCCCCcccccCCCCCCcceecccCccCCCCCCceeCcCCcCcccC
Q psy12696        206 DMPVDPNEPTYCVCQQVSYGEMIGCDNPDCPIEWFHFACVSLTTKPKGKWYCPKCTSDRKK  266 (267)
Q Consensus       206 ~~~~~~~~~~~C~C~~~~~~~mi~Cd~~~c~~~wfH~~Cv~l~~~p~~~w~C~~C~~~~~~  266 (267)
                      +.+.|+++.+||+|+++.+++||.|+++.|+.+|||+.||||+..|.++||||.|..+..+
T Consensus         8 ~~~~d~~e~~~CiC~~~~~~~~i~c~~~~C~~~wfH~~Cvgl~~~p~~~w~C~~C~~~~gp   68 (71)
T d1wesa_           8 EFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDSGP   68 (71)
T ss_dssp             CSCCCSSSCCCSTTCCCCCSSEECCSCTTCSCCCEETTTTTCSSCCSSCCCCTTTSSCCSC
T ss_pred             CCCcCCCCCCEEEeCCCCCCCEEEEECCCCCCcCccCccCCCCcCCCCcEECcCCccccCc
Confidence            5678889999999999988999999888888899999999999999999999999876554
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d2v89a1 g.50.1.2 (A:1414-1487) V(D)J recombination-activating protein 2, Rag2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]} Back     information, alignment and structure
>d1weqa_ g.50.1.2 (A:) PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure