Diaphorina citri psyllid: psy12707

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----

MVFLCQRNCSLKEYKSKVVSCKRNETRPTEYHVRMEDTIFFPTGGGQHCDKGTLGGVEVVDVYRDGDEAVHVVNKEFQVGELLDMKIDWAHRLDQTQQHTGQHLLSAVIDKMFGYDTESWNCGSDVCDVELATKDKDLTEADIAAIEQECNNKIRQGVKVWASEYQPGDPALKTAHTRGLPKDHKGSIRIVHIDGIDNNMCCGTHVDNISQLQSIKLLKTTRAQKSKSLCIYLYLLGRRLMIQEL

ccccccccccccCEEEEEEEEEEccccccEEEEEEcccccccccccccccCEEEcEEEEEEEEEEccEEEEEEccccccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEECccccccccHHHHHHHHHHHHHHHHccccEEEEECcccHHHHHccccccccccccccEEEEEEcccEEccccccccccccccccEEEEEEEEccccccEEEEEEEEcHHHHHHHc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVFLCQRNCSLKEYKSKVVSCKRNETRPTEYHVRMEDTIFFPTGGGQHCDKGTLGGVEVVDVYRDGDEAVHVVNKEFQVGELLDMKIDWAHRLDQTQQHTGQHLLSAVIDKMFGYDTESWNCGSDVCDxxxxxxxxxxxxxxxxxxxxxxxxxxxxGVKVWASEYQPGDPALKTAHTRGLPKDHKGSIRIVHIDGIDNNMCCGTHVDNISQLQSIKLLKTTRAQKSKSLCIYLYLLGRRLMIQEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Alanyl-tRNA editing protein AlaX-M	Functions in trans to edit the amino acid moiety from incorrectly charged Ser-tRNA(Ala) or Gly-tRNA(Ala). Has no activity on incorrectly charged Ser-tRNA(Thr), nor on correctly charged Ala-tRNA(Ala) or Ser-tRNA(Ser).	confident	Q46AR9

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0006450 [BP]	regulation of translational fidelity	probable	GO:0009889, GO:0032268, GO:0006448, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0006417, GO:0008150, GO:0065008, GO:0010468
GO:0002161 [MF]	aminoacyl-tRNA editing activity	probable	GO:0016787, GO:0003674, GO:0016788, GO:0052689, GO:0003824

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KEW, chain A
Confidence level:very confident
Coverage over the Query: 3-241
View the alignment between query and template
View the model in PyMOL