Diaphorina citri psyllid: psy12713

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-
MFMDRGAQHAKEEISKRSFFKPSKQFIKTYLKSFPNDPILQPDGLSNGVELTNGDTNESHELDLLSKAKRAFEHEDYLTAIRHCTEEIESTSSNHTKALARLLRATVYIFTSQSTKAIEDLTQLVEDTSVDPKIKVNAHIKRAVVHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVVHKMIVPGDRERVEQSLKEFRNFVDTHSNVVEACTLFAQVLVDQEDFDGAEEYFNRSIRVDPENASLYVHRAMLMLQARGNVDEAIKLIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAAIAQMKVCERYNIKKKVSPRSQNITKNEKLAIKQLRENNDIIIRPADKGGKTVVMDKADYTQKMTSILNSNDYEIIPGDPTKTIEESEKYGNLENESGQKHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVWTSTLAELMAFSDEFMIPKITYYIL
ccHHHHHHHHHHHHHccccccccHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHcHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccc
MFMDR**QHAKEEISKRSFFKPSKQFIKTYLKSFPNDPILQPDGLSNGVELTNGDTNESHELDLLSKAKRAFEHEDYLTAIRHCTEEIESTSSNHTKALARLLRATVYIFTSQSTKAIEDLTQLVEDTSVDPKIKVNAHIKRAVVHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVVHKMIVPGDRERVEQSLKEFRNFVDTHSNVVEACTLFAQVLVDQEDFDGAEEYFNRSIRVDPENASLYVHRAMLMLQARGNVDEAIKLIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAAIAQMKVCERYNIKKKVSPRSQNITKNEKLAIKQLRENNDIIIRPADKGGKTVVMDKADYTQKMTSILNSNDYEIIPGDPTKTIEESEKYGNLENESGQKHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVWTSTLAELMAFSDEFMIPKITYYIL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFMDRGAQHAKEEISKRSFFKPSKQFIKTYLKSFPNDPILQPDGLSNGVELTNGDTNESHELDLLSKAKRAFEHEDYLTAIRHCTEEIESTSSNHTKALARLLRATVYIFTSQSTKAIEDLTQLVEDTSVDPKIKVNAHIKRAVVHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVVHKMIVPGDRERVEQSLKEFRNFVDTHSNVVEACTLFAQVLVDQEDFDGAEEYFNRSIRVDPENASLYVHRAMLMLQARGNVDEAIKLIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAAIAQMKVCERYNIKKKVSPRSQNITKNEKLAIKQLRENNDIIIRPADKGGKTVVMDKADYTQKMTSILNSNDYEIIPGDPTKTIEESEKYGNLENESGQKHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVWTSTLAELMAFSDEFMIPKITYYIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial import receptor subunit TOM70 Receptor that accelerates the import of all mitochondrial precursor proteins.confidentO94826

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W3B, chain A
Confidence level:very confident
Coverage over the Query: 60-359,383-397,432-437,449-498
View the alignment between query and template
View the model in PyMOL
Template: 1W3B, chain A
Confidence level:very confident
Coverage over the Query: 66-361,385-399,434-440,451-532
View the alignment between query and template
View the model in PyMOL
Template: 3LY7, chain A
Confidence level:very confident
Coverage over the Query: 4-37,59-206
View the alignment between query and template
View the model in PyMOL
Template: 4E6H, chain A
Confidence level:confident
Coverage over the Query: 77-397,435-533
View the alignment between query and template
View the model in PyMOL
Template: 3UGM, chain A
Confidence level:probable
Coverage over the Query: 75-404,415-527
View the alignment between query and template
View the model in PyMOL