Psyllid ID: psy12713


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-
MFMDRGAQHAKEEISKRSFFKPSKQFIKTYLKSFPNDPILQPDGLSNGVELTNGDTNESHELDLLSKAKRAFEHEDYLTAIRHCTEEIESTSSNHTKALARLLRATVYIFTSQSTKAIEDLTQLVEDTSVDPKIKVNAHIKRAVVHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVVHKMIVPGDRERVEQSLKEFRNFVDTHSNVVEACTLFAQVLVDQEDFDGAEEYFNRSIRVDPENASLYVHRAMLMLQARGNVDEAIKLIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAAIAQMKVCERYNIKKKVSPRSQNITKNEKLAIKQLRENNDIIIRPADKGGKTVVMDKADYTQKMTSILNSNDYEIIPGDPTKTIEESEKYGNLENESGQKHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVWTSTLAELMAFSDEFMIPKITYYIL
cHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHcHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccc
ccHHHHHHHHHHHHHccccccccHHHHHHHHHHcHHHHHHcHHHHHHcHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHccccEEEc
mfmdrgaqhakeeiskrsffkpsKQFIKTYLksfpndpilqpdglsngveltngdtneshELDLLSKAKRAFEHEDYLTAIRHCTEEIESTSSNHTKALARLLRATVYIFTSQSTKAIEDLTQLvedtsvdpkikvNAHIKRAVVHLHAASDFTKAFADldeaekvdpnvadsyyqrgqIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVVHkmivpgdreRVEQSLKEFRNFVDTHSNVVEACTLFAQVLVdqedfdgaeEYFNRsirvdpenaSLYVHRAMLMLQARGNVDEAIKLIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAAIAQMKVCERynikkkvsprsqnitkNEKLAIKQLREnndiiirpadkggktvvmdkADYTQKMTSIlnsndyeiipgdptktieesekygnlenesgqkhAASDFTKAFAdldeaekvdpnvadsyyqrgqIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVWTSTLAELMAFsdefmipkityyil
mfmdrgaqhakeeiskrsffkpsKQFIKTYLKSFPNDPILQPDGLSNGVELTNGDTNESHELDLLSKAKRAFEHEDYLTAIRHCTeeiestssnHTKALARLLRATVYIFTSQSTKAIEDLTQLVEDTSVDPKIKVNAHIKRAVVHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVVHKMIVPGDRERVEQSLKEFRNFVDTHSNVVEACTLFAQVLVDQEDFDGAEEYFNrsirvdpeNASLYVHRAMLMLQARGNVDEAIKLIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAAIAQMKVCERYNikkkvsprsqnitkneklaikqlrenndiiirpadkggktvvMDKADYTQKMtsilnsndyeiipGDPTKTIEESEKYGNLENESGQKHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVWTSTLAELmafsdefmipkitYYIL
MFMDRGAQHAKEEISKRSFFKPSKQFIKTYLKSFPNDPILQPDGLSNGVELTNGDTNESHELDLLSKAKRAFEHEDYLTAIRHCTEEIESTSSNHTKALARLLRATVYIFTSQSTKAIEDLTQLVEDTSVDPKIKVNAHIKRAVVHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVVHKMIVPGDRERVEQSLKEFRNFVDTHSNVVEACTLFAQVLVDQEDFDGAEEYFNRSIRVDPENASLYVHRAMLMLQARGNVDEAIKLIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAAIAQMKVCERYNIKKKVSPRSQNITKNEKLAIKQLRENNDIIIRPADKGGKTVVMDKADYTQKMTSILNSNDYEIIPGDPTKTIEESEKYGNLENESGQKHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVWTSTLAELMAFSDEFMIPKITYYIL
*************************FIKTYLKSF***********************************RAFEHEDYLTAIRHCTEEIE*****HTKALARLLRATVYIFTSQSTKAIEDLTQLVEDTSVDPKIKVNAHIKRAVVHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVVHKMIVPGDRERVEQSLKEFRNFVDTHSNVVEACTLFAQVLVDQEDFDGAEEYFNRSIRVDPENASLYVHRAMLMLQARGNVDEAIKLIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAAIAQMKVCERYNIKK***************AIKQLRENNDIIIRPADKGGKTVVMDKADYTQKMTSILNSNDYEI*********************************************PNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVWTSTLAELMAFSDEFMIPKITYYI*
MFMDR**QHAKEEISKRSFFKPSKQFIKTYLKSFPNDPILQPDGLSNGVELTNGDTNESHELDLLSKAKRAFEHEDYLTAIRHCTEEIESTSSNHTKALARLLRATVYIFTSQSTKAIEDLTQLVEDTSVDPKIKVNAHIKRAVVHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVVHKMIVPGDRERVEQSLKEFRNFVDTHSNVVEACTLFAQVLVDQEDFDGAEEYFNRSIRVDPENASLYVHRAMLMLQARGNVDEAIKLIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAAIAQMKVCERYNIKKKVSPRSQNITKNEKLAIKQLRENNDIIIRPADKGGKTVVMDKADYTQKMTSILNSNDYEIIPGDPTKTIEESEKYGNLENESGQKHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVWTSTLAELMAFSDEFMIPKITYYIL
*************ISKRSFFKPSKQFIKTYLKSFPNDPILQPDGLSNGVELTNGDTNESHELDLLSKAKRAFEHEDYLTAIRHCTEEIESTSSNHTKALARLLRATVYIFTSQSTKAIEDLTQLVEDTSVDPKIKVNAHIKRAVVHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVVHKMIVPGDRERVEQSLKEFRNFVDTHSNVVEACTLFAQVLVDQEDFDGAEEYFNRSIRVDPENASLYVHRAMLMLQARGNVDEAIKLIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAAIAQMKVCERYNIKKKVSPRSQNITKNEKLAIKQLRENNDIIIRPADKGGKTVVMDKADYTQKMTSILNSNDYEIIPGDPTKTIEESEKYGNLENESGQKHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVWTSTLAELMAFSDEFMIPKITYYIL
MFMDRGAQHAKEEISKRSFFKPSKQFIKTYLKSFPNDPILQPDGLSNGVELTNGDTNESHELDLLSKAKRAFEHEDYLTAIRHCTEEIESTSSNHTKALARLLRATVYIFTSQSTKAIEDLTQLVEDTSVDPKIKVNAHIKRAVVHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVVHKMIVPGDRERVEQSLKEFRNFVDTHSNVVEACTLFAQVLVDQEDFDGAEEYFNRSIRVDPENASLYVHRAMLMLQARGNVDEAIKLIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAAIAQMKVCERYNIKKKVSPRSQNITKNEKLAIKQLRENNDIIIRPADKGGKTVVMDKADYTQKMTSILNSNDYEIIPGDPTKTIEESEKYGNLENESGQKHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVWTSTLAELMAFSDEFMIPKITYYIL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFMDRGAQHAKEEISKRSFFKPSKQFIKTYLKSFPNDPILQPDGLSNGVELTNGDTNESHELDLLSKAKRAFEHEDYLTAIRHCTEEIESTSSNHTKALARLLRATVYIFTSQSTKAIEDLTQLVEDTSVDPKIKVNAHIKRAVVHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVVHKMIVPGDRERVEQSLKEFRNFVDTHSNVVEACTLFAQVLVDQEDFDGAEEYFNRSIRVDPENASLYVHRAMLMLQARGNVDEAIKLIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAAIAQMKVCERYNIKKKVSPRSQNITKNEKLAIKQLRENNDIIIRPADKGGKTVVMDKADYTQKMTSILNSNDYEIIPGDPTKTIEESEKYGNLENESGQKHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVWTSTLAELMAFSDEFMIPKITYYIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query551 2.2.26 [Sep-21-2011]
O94826608 Mitochondrial import rece yes N/A 0.662 0.600 0.373 2e-65
Q9CZW5611 Mitochondrial import rece yes N/A 0.662 0.597 0.370 1e-64
Q75Q39610 Mitochondrial import rece yes N/A 0.662 0.598 0.370 2e-64
P23231624 Mitochondrial import rece N/A N/A 0.615 0.543 0.280 1e-28
O14217625 Probable mitochondrial im yes N/A 0.591 0.521 0.259 8e-23
P07213617 Mitochondrial import rece yes N/A 0.426 0.380 0.264 7e-12
A6ZRW3617 Mitochondrial import rece N/A N/A 0.426 0.380 0.264 7e-12
Q58741314 TPR repeat-containing pro yes N/A 0.417 0.732 0.217 2e-10
Q58350318 TPR repeat-containing pro no N/A 0.297 0.515 0.267 4e-08
P38825639 Protein TOM71 OS=Saccharo no N/A 0.370 0.319 0.244 1e-07
>sp|O94826|TOM70_HUMAN Mitochondrial import receptor subunit TOM70 OS=Homo sapiens GN=TOMM70A PE=1 SV=1 Back     alignment and function desciption
 Score =  250 bits (638), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 139/372 (37%), Positives = 215/372 (57%), Gaps = 7/372 (1%)

Query: 6   GAQHAKEEISKRSFFKPSKQFIKTYLKSFPNDPILQP---DGLSNGVELTNGDTNESHEL 62
           G + AKE+   R    PS QFIK+Y  SF +D I QP      S+  +   G+  E  E 
Sbjct: 236 GKEKAKEKYKNREPLMPSPQFIKSYFSSFTDDIISQPMLKGEKSDEDKDKEGEALEVKEN 295

Query: 63  DLLSKAKRAFEHEDYLTAIRHCTEEIESTSSNHTKALARLLRATVYIFTSQSTKAIEDLT 122
               KAK+  E E+Y   I  C++EI++      +AL  LLRAT Y+    +  A  DL 
Sbjct: 296 SGYLKAKQYMEEENYDKIISECSKEIDAEGKYMAEAL--LLRATFYLLIGNANAAKPDLD 353

Query: 123 QLVEDTSVDPKIKVNAHIKRAVVHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYC 182
           +++     + K++ NA IKR  +++        +  D + A  +DP  AD Y+ RGQ+  
Sbjct: 354 KVISLKEANVKLRANALIKRGSMYMQQQQPLL-STQDFNMAADIDPQNADVYHHRGQLKI 412

Query: 183 LFGQYEEALRNLDKTIALNPNFHVARAQRHFVVHKMIVPGDRE-RVEQSLKEFRNFVDTH 241
           L  Q EEA+ + D+ I L P   +A+AQ+ F +++    G+   +++ ++K F   +   
Sbjct: 413 LLDQVEEAVADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKF 472

Query: 242 SNVVEACTLFAQVLVDQEDFDGAEEYFNRSIRVDPENASLYVHRAMLMLQARGNVDEAIK 301
               E   L+AQ L DQ+ F  A+E +++ I ++P+NA+ YVH+ +L LQ + ++D  ++
Sbjct: 473 PRCAEGYALYAQALTDQQQFGKADEMYDKCIDLEPDNATTYVHKGLLQLQWKQDLDRGLE 532

Query: 302 LIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAAI 361
           LI KAI ID  C FAYET+GTIEVQRG +E+A+  FNKA+ LA+ E E++H+YSL DAA 
Sbjct: 533 LISKAIEIDNKCDFAYETMGTIEVQRGNMEKAIDMFNKAINLAKSEMEMAHLYSLCDAAH 592

Query: 362 AQMKVCERYNIK 373
           AQ +V ++Y +K
Sbjct: 593 AQTEVAKKYGLK 604




Receptor that accelerates the import of all mitochondrial precursor proteins.
Homo sapiens (taxid: 9606)
>sp|Q9CZW5|TOM70_MOUSE Mitochondrial import receptor subunit TOM70 OS=Mus musculus GN=Tomm70a PE=1 SV=2 Back     alignment and function description
>sp|Q75Q39|TOM70_RAT Mitochondrial import receptor subunit TOM70 OS=Rattus norvegicus GN=Tomm70a PE=1 SV=1 Back     alignment and function description
>sp|P23231|TOM70_NEUCR Mitochondrial import receptor subunit tom-70 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tom-70 PE=2 SV=2 Back     alignment and function description
>sp|O14217|TOM70_SCHPO Probable mitochondrial import receptor subunit tom70 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tom70 PE=1 SV=1 Back     alignment and function description
>sp|P07213|TOM70_YEAST Mitochondrial import receptor subunit TOM70 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM70 PE=1 SV=2 Back     alignment and function description
>sp|A6ZRW3|TOM70_YEAS7 Mitochondrial import receptor subunit TOM70 OS=Saccharomyces cerevisiae (strain YJM789) GN=TOM70 PE=3 SV=1 Back     alignment and function description
>sp|Q58741|Y1345_METJA TPR repeat-containing protein MJ1345 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1345 PE=4 SV=1 Back     alignment and function description
>sp|Q58350|Y940_METJA TPR repeat-containing protein MJ0940 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0940 PE=4 SV=1 Back     alignment and function description
>sp|P38825|TOM71_YEAST Protein TOM71 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM71 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query551
291240441575 PREDICTED: super sex combs-like [Saccogl 0.666 0.638 0.388 4e-69
270005628557 hypothetical protein TcasGA2_TC007711 [T 0.646 0.639 0.425 2e-68
189236082 1440 PREDICTED: similar to rCG36659 [Triboliu 0.646 0.247 0.425 9e-68
357604397547 putative heat shock protein 70-interacti 0.635 0.639 0.402 2e-67
344294611610 PREDICTED: mitochondrial import receptor 0.664 0.6 0.381 5e-66
327268894548 PREDICTED: mitochondrial import receptor 0.656 0.660 0.381 7e-66
449277464501 Mitochondrial import receptor subunit TO 0.662 0.728 0.381 1e-65
126325626612 PREDICTED: mitochondrial import receptor 0.662 0.596 0.381 1e-65
326912988515 PREDICTED: mitochondrial import receptor 0.662 0.708 0.384 2e-65
156550027575 PREDICTED: mitochondrial import receptor 0.640 0.613 0.391 2e-65
>gi|291240441|ref|XP_002740127.1| PREDICTED: super sex combs-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
 Score =  268 bits (686), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 145/373 (38%), Positives = 226/373 (60%), Gaps = 6/373 (1%)

Query: 4   DRGAQHAKEEISKRSFFKPSKQFIKTYLKSFPNDPILQP--DGLSNGVELTNGDTNESHE 61
           D G + AK++ S R+   PSKQFIK+Y  SF  D   QP   G ++  +    ++ E+ +
Sbjct: 202 DMGKEKAKKKYSTRTPSMPSKQFIKSYFSSFAQDITTQPLEKGDNDDEDKDKDESVETPK 261

Query: 62  LDLLSKAKRAFEHEDYLTAIRHCTEEIESTSSNHTKALARLLRATVYIFTSQSTKAIEDL 121
                KA+  F++EDY   I  CT+EI+S       A+  L+RAT Y+   Q+      L
Sbjct: 262 SSGYRKAREYFDNEDYDKIIDECTKEIDSEGPCMAHAV--LMRATFYMLKGQANLGKPGL 319

Query: 122 TQLVEDTSVDPKIKVNAHIKRAVVHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIY 181
             +++  S D  ++VNA IKR  +++   +  T+A  D  +A ++DP  AD Y+ RGQ+ 
Sbjct: 320 DDVIDMESADKMLRVNALIKRGSMYMQQGNS-TEALNDFAQAVRIDPENADIYHHRGQLN 378

Query: 182 CLFGQYEEALRNLDKTIALNPNFHVARAQRHFVVHKM-IVPGDRERVEQSLKEFRNFVDT 240
            L  + +EAL++ +K ++LNP F +A+AQ  + +++         +++ ++  F   +  
Sbjct: 379 VLLDRVDEALKDFEKCVSLNPGFALAQAQHCYAMYRAAFAQRSPMQLQAAMNAFEKVIKD 438

Query: 241 HSNVVEACTLFAQVLVDQEDFDGAEEYFNRSIRVDPENASLYVHRAMLMLQARGNVDEAI 300
             N  E   LFAQ L DQ+ +  A+E F ++++++PEN + YVHR +LMLQ + +VD A+
Sbjct: 439 FPNCAEGYALFAQALNDQQQYSQADEMFLKAMKLEPENPTTYVHRGLLMLQWKQDVDTAV 498

Query: 301 KLIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAA 360
           KL++K++ ID  C FAYETLGTIEVQRG LE A++ F KA+ LAR E E++H+YSL DAA
Sbjct: 499 KLMKKSLEIDDKCDFAYETLGTIEVQRGNLEHAIQLFEKAIDLARTEMEMAHLYSLLDAA 558

Query: 361 IAQMKVCERYNIK 373
           IAQ +V   YNI+
Sbjct: 559 IAQTRVATMYNIR 571




Source: Saccoglossus kowalevskii

Species: Saccoglossus kowalevskii

Genus: Saccoglossus

Family: Harrimaniidae

Order:

Class: Enteropneusta

Phylum: Hemichordata

Superkingdom: Eukaryota

>gi|270005628|gb|EFA02076.1| hypothetical protein TcasGA2_TC007711 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189236082|ref|XP_972621.2| PREDICTED: similar to rCG36659 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357604397|gb|EHJ64169.1| putative heat shock protein 70-interacting protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|344294611|ref|XP_003419010.1| PREDICTED: mitochondrial import receptor subunit TOM70 [Loxodonta africana] Back     alignment and taxonomy information
>gi|327268894|ref|XP_003219230.1| PREDICTED: mitochondrial import receptor subunit TOM70-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|449277464|gb|EMC85620.1| Mitochondrial import receptor subunit TOM70, partial [Columba livia] Back     alignment and taxonomy information
>gi|126325626|ref|XP_001363876.1| PREDICTED: mitochondrial import receptor subunit TOM70 [Monodelphis domestica] Back     alignment and taxonomy information
>gi|326912988|ref|XP_003202825.1| PREDICTED: mitochondrial import receptor subunit TOM70-like [Meleagris gallopavo] Back     alignment and taxonomy information
>gi|156550027|ref|XP_001604755.1| PREDICTED: mitochondrial import receptor subunit TOM70-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query551
UNIPROTKB|F1NNH9599 TOMM70A "Uncharacterized prote 0.662 0.609 0.381 7.6e-64
UNIPROTKB|Q08E34609 TOMM70A "Translocase of outer 0.662 0.599 0.373 1.1e-62
UNIPROTKB|O94826608 TOMM70A "Mitochondrial import 0.662 0.600 0.373 2.3e-62
MGI|MGI:106295611 Tomm70a "translocase of outer 0.662 0.597 0.370 1.6e-61
RGD|1303049610 Tomm70a "translocase of outer 0.662 0.598 0.370 2.1e-61
FB|FBgn0032397589 Tom70 "Translocase of outer me 0.675 0.631 0.366 1.2e-58
ASPGD|ASPL0000066455636 AN7687 [Emericella nidulans (t 0.626 0.542 0.269 6e-27
POMBASE|SPAC6B12.12625 tom70 "mitochondrial TOM compl 0.535 0.472 0.252 4.3e-21
SGD|S000005065617 TOM70 "Component of the TOM (t 0.571 0.510 0.262 1.8e-13
CGD|CAL0001055629 TOM70 [Candida albicans (taxid 0.618 0.542 0.220 1.8e-11
UNIPROTKB|F1NNH9 TOMM70A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 651 (234.2 bits), Expect = 7.6e-64, P = 7.6e-64
 Identities = 142/372 (38%), Positives = 218/372 (58%)

Query:     6 GAQHAKEEISKRSFFKPSKQFIKTYLKSFPNDPILQP--DGLSNGVELTN-GDTNESHEL 62
             G + AKE+   R    PS QFIK+Y  SF +D I QP   G  +  +    G+ +E  E 
Sbjct:   227 GKEKAKEKYKNREPLMPSPQFIKSYFSSFTDDIISQPLLKGEKSDEDKDKEGEASEVKEN 286

Query:    63 DLLSKAKRAFEHEDYLTAIRHCTEEIESTSSNHTKALARLLRATVYIFTSQSTKAIEDLT 122
                 +AK+  E E+Y   I  CT+EIE+      +AL  LLRAT Y+    +  A  DL 
Sbjct:   287 SGYLRAKQYMEEENYDKIISECTKEIEAKGKYMAEAL--LLRATFYLLIGNANAAKPDLD 344

Query:   123 QLVEDTSVDPKIKVNAHIKRAVVHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYC 182
             Q++     + K++ NA IKR  +++           D + A  +DP  AD Y+ RGQ+  
Sbjct:   345 QVISMEDANVKLRANALIKRGSMYMQQQQPALST-QDFNMAADIDPQNADVYHHRGQLKI 403

Query:   183 LFGQYEEALRNLDKTIALNPNFHVARAQRHFVVHKMIVPGDRER-VEQSLKEFRNFVDTH 241
             L  Q EEA+ + D+ I L P+  +A+AQ+ F +++    G+    V+ ++K F + +   
Sbjct:   404 LLDQIEEAVEDFDECIRLRPDSALAQAQKCFALYRQAYTGNNPLPVQVAMKGFEDVIKKF 463

Query:   242 SNVVEACTLFAQVLVDQEDFDGAEEYFNRSIRVDPENASLYVHRAMLMLQARGNVDEAIK 301
                 E   L+AQ L DQ+ F  A+E +++ I ++P+NA+ YVH+ +L LQ + ++D+ ++
Sbjct:   464 PKCAEGYALYAQALTDQQQFGKADEMYDKCIDLEPDNATTYVHKGLLQLQWKQDLDKGLE 523

Query:   302 LIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAAI 361
             LI KAI ID  C FAYET+GTIEVQRG L++A++ FNKA+ LA+ E E++H+YSL DAA 
Sbjct:   524 LISKAIEIDNKCDFAYETMGTIEVQRGNLDKAIEMFNKAINLAKSEMEMAHLYSLCDAAY 583

Query:   362 AQMKVCERYNIK 373
             AQ +V ++Y +K
Sbjct:   584 AQTEVAKKYGLK 595


GO:0005739 "mitochondrion" evidence=IEA
UNIPROTKB|Q08E34 TOMM70A "Translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O94826 TOMM70A "Mitochondrial import receptor subunit TOM70" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:106295 Tomm70a "translocase of outer mitochondrial membrane 70 homolog A (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1303049 Tomm70a "translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0032397 Tom70 "Translocase of outer membrane 70" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ASPGD|ASPL0000066455 AN7687 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
POMBASE|SPAC6B12.12 tom70 "mitochondrial TOM complex subunit Tom70 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000005065 TOM70 "Component of the TOM (translocase of outer membrane) complex" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
CGD|CAL0001055 TOM70 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O94826TOM70_HUMANNo assigned EC number0.37360.66240.6003yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query551
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 2e-34
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-15
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-14
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-14
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 3e-13
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-12
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 8e-11
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-09
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-09
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-09
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-09
pfam1341469 pfam13414, TPR_11, TPR repeat 3e-09
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-09
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-07
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 5e-07
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-06
pfam1341469 pfam13414, TPR_11, TPR repeat 4e-06
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 5e-06
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 6e-06
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 2e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-05
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 2e-05
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 3e-05
PRK11788389 PRK11788, PRK11788, tetratricopeptide repeat prote 3e-05
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-05
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 4e-05
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 4e-05
COG4235287 COG4235, COG4235, Cytochrome c biogenesis factor [ 5e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 9e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 9e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 9e-05
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-04
smart0002834 smart00028, TPR, Tetratricopeptide repeats 3e-04
smart0002834 smart00028, TPR, Tetratricopeptide repeats 3e-04
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 3e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 5e-04
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 0.001
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.002
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.002
PLN03088356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 0.002
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
 Score =  137 bits (345), Expect = 2e-34
 Identities = 106/370 (28%), Positives = 180/370 (48%), Gaps = 27/370 (7%)

Query: 10  AKEEISKRSFFKPSKQFIKTYLKSFPNDPILQPDGLSNGVELTNGDTNESHELDLLSKAK 69
           AKE +  +    PS  F+  YL+SF   P  +P GL +  EL     +E      L    
Sbjct: 247 AKEILETKPENLPSVTFVGNYLQSFRPKP--RPAGLEDSNEL-----DEETGNGQLQLGL 299

Query: 70  RAFEH---EDYLTAIRHCTEEIESTSSNHTKALARLLRATVYIFTSQSTKAIEDLTQLVE 126
           ++ E    E Y  A R   + ++       +A+A  LR T      +  +A+ DL++ +E
Sbjct: 300 KSPESKADESYEEAARAFEKALDLGKLGEKEAIALNLRGTFKCLKGKHLEALADLSKSIE 359

Query: 127 DTSVDPKIKVNAHIKRAVVHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQ 186
              +DP++   ++IKRA ++L    D  KA  D D+A K++    D YY R Q++ + G+
Sbjct: 360 ---LDPRVT-QSYIKRASMNLEL-GDPDKAEEDFDKALKLNSEDPDIYYHRAQLHFIKGE 414

Query: 187 YEEALRNLDKTIALNPNFHVARAQRHFVVHKMIVPGDRERVEQSLKEFRNFVDTHSNVVE 246
           + +A ++  K+I L+P+F  +  Q     +K         +  S+  FR          +
Sbjct: 415 FAQAGKDYQKSIDLDPDFIFSHIQLGVTQYKE------GSIASSMATFRRCKKNFPEAPD 468

Query: 247 ACTLFAQVLVDQEDFDGAEEYFNRSIRVDPENASLY------VHRAMLMLQARGNVDEAI 300
               + ++L+DQ  FD A E F+ +I ++ E   +Y      +++A+ + Q + +  EA 
Sbjct: 469 VYNYYGELLLDQNKFDEAIEKFDTAIELEKETKPMYMNVLPLINKALALFQWKQDFIEAE 528

Query: 301 KLIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAA 360
            L EKA+ ID  C  A  T+  + +Q+G ++EA+K F +A  LAR E EL    S  +A 
Sbjct: 529 NLCEKALIIDPECDIAVATMAQLLLQQGDVDEALKLFERAAELARTEGELVQAISYAEAT 588

Query: 361 IAQMKVCERY 370
             Q++V E Y
Sbjct: 589 RTQIQVQEDY 598


[Transport and binding proteins, Amino acids, peptides and amines]. Length = 615

>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|236983 PRK11788, PRK11788, tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|226687 COG4235, COG4235, Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 551
KOG4626|consensus 966 100.0
KOG4626|consensus 966 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
KOG0547|consensus606 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 100.0
KOG2002|consensus 1018 100.0
KOG0547|consensus606 100.0
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.97
KOG2002|consensus 1018 99.97
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.97
KOG1126|consensus638 99.97
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.96
KOG1155|consensus559 99.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.96
KOG1126|consensus638 99.96
KOG0624|consensus504 99.96
PRK11788389 tetratricopeptide repeat protein; Provisional 99.96
PRK11788389 tetratricopeptide repeat protein; Provisional 99.95
KOG1173|consensus611 99.95
KOG0548|consensus539 99.95
KOG2076|consensus 895 99.94
KOG1155|consensus559 99.94
PRK14574 822 hmsH outer membrane protein; Provisional 99.94
KOG0548|consensus539 99.94
KOG0624|consensus 504 99.93
KOG2003|consensus 840 99.93
KOG0495|consensus913 99.92
KOG1173|consensus611 99.92
KOG0495|consensus913 99.92
KOG2076|consensus 895 99.92
KOG2003|consensus 840 99.91
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.91
PRK14574 822 hmsH outer membrane protein; Provisional 99.91
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.9
KOG1174|consensus564 99.9
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.9
PRK12370553 invasion protein regulator; Provisional 99.9
KOG4162|consensus799 99.9
KOG1156|consensus 700 99.89
KOG0550|consensus486 99.89
KOG4162|consensus799 99.89
KOG1129|consensus478 99.88
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.88
PRK11189296 lipoprotein NlpI; Provisional 99.88
PRK12370553 invasion protein regulator; Provisional 99.88
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.88
KOG1125|consensus579 99.88
KOG1129|consensus478 99.88
KOG1174|consensus564 99.87
PRK11189296 lipoprotein NlpI; Provisional 99.87
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.86
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.86
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.86
KOG0550|consensus486 99.86
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.85
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.85
KOG1125|consensus579 99.85
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.85
KOG1127|consensus 1238 99.84
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.83
PLN03218 1060 maturation of RBCL 1; Provisional 99.83
PLN03218 1060 maturation of RBCL 1; Provisional 99.83
PLN03077 857 Protein ECB2; Provisional 99.82
PLN02789320 farnesyltranstransferase 99.82
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.82
KOG1156|consensus 700 99.81
PLN02789320 farnesyltranstransferase 99.8
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.8
KOG1127|consensus 1238 99.8
PLN03077857 Protein ECB2; Provisional 99.78
KOG1840|consensus508 99.77
KOG2376|consensus 652 99.76
KOG1840|consensus508 99.75
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.75
KOG1915|consensus 677 99.75
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.73
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.73
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.71
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.7
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.7
KOG3785|consensus557 99.68
PRK10370198 formate-dependent nitrite reductase complex subuni 99.66
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.65
KOG1915|consensus 677 99.64
PRK15359144 type III secretion system chaperone protein SscB; 99.63
PRK15359144 type III secretion system chaperone protein SscB; 99.63
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.63
KOG3785|consensus557 99.62
KOG3060|consensus289 99.62
KOG3060|consensus289 99.62
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.61
KOG1130|consensus639 99.59
KOG4340|consensus459 99.58
PRK10370198 formate-dependent nitrite reductase complex subuni 99.58
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.58
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.56
KOG2376|consensus 652 99.56
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.55
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.53
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.52
KOG1128|consensus777 99.51
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.5
KOG1130|consensus 639 99.48
PRK04841 903 transcriptional regulator MalT; Provisional 99.48
KOG1128|consensus777 99.47
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.47
PRK04841903 transcriptional regulator MalT; Provisional 99.47
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.45
KOG0553|consensus304 99.45
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.45
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.43
KOG4340|consensus459 99.42
KOG0553|consensus304 99.42
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.42
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.41
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.37
KOG2047|consensus835 99.36
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.35
KOG2047|consensus 835 99.35
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.34
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.31
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.31
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.29
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.28
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.28
KOG1941|consensus518 99.26
KOG2053|consensus 932 99.25
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.24
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.23
PF13512142 TPR_18: Tetratricopeptide repeat 99.21
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.2
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.2
KOG3081|consensus299 99.18
PRK11906458 transcriptional regulator; Provisional 99.17
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.16
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.15
PRK10803263 tol-pal system protein YbgF; Provisional 99.15
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.14
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.14
KOG4648|consensus 536 99.13
COG4105254 ComL DNA uptake lipoprotein [General function pred 99.13
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.12
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.12
COG1729262 Uncharacterized protein conserved in bacteria [Fun 99.1
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.1
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.09
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.08
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.08
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.08
PRK11906458 transcriptional regulator; Provisional 99.07
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.06
COG0457291 NrfG FOG: TPR repeat [General function prediction 99.05
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.05
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.04
KOG1070|consensus1710 99.04
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.04
KOG0543|consensus397 99.04
KOG0543|consensus397 99.03
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.03
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.02
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.01
KOG4648|consensus536 99.01
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 99.01
COG0457291 NrfG FOG: TPR repeat [General function prediction 99.0
PRK15331165 chaperone protein SicA; Provisional 99.0
KOG1941|consensus518 99.0
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.99
PRK15331165 chaperone protein SicA; Provisional 98.97
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.93
KOG1070|consensus1710 98.93
PRK10803263 tol-pal system protein YbgF; Provisional 98.93
KOG3081|consensus299 98.88
COG3898531 Uncharacterized membrane-bound protein [Function u 98.87
KOG4234|consensus271 98.86
PF12688120 TPR_5: Tetratrico peptide repeat 98.86
PF1337173 TPR_9: Tetratricopeptide repeat 98.85
KOG2053|consensus 932 98.85
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.81
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.8
PF12688120 TPR_5: Tetratrico peptide repeat 98.78
PF13512142 TPR_18: Tetratricopeptide repeat 98.78
KOG2471|consensus 696 98.77
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.76
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.73
KOG4555|consensus175 98.72
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.71
KOG3617|consensus 1416 98.7
KOG4234|consensus271 98.69
PF1337173 TPR_9: Tetratricopeptide repeat 98.66
KOG2300|consensus 629 98.66
COG3898531 Uncharacterized membrane-bound protein [Function u 98.65
KOG2796|consensus366 98.54
COG4700251 Uncharacterized protein conserved in bacteria cont 98.54
COG4700251 Uncharacterized protein conserved in bacteria cont 98.52
PF1342844 TPR_14: Tetratricopeptide repeat 98.51
KOG1586|consensus288 98.49
KOG1585|consensus308 98.48
KOG2796|consensus366 98.48
KOG3617|consensus 1416 98.48
KOG2471|consensus696 98.46
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.43
KOG1914|consensus 656 98.43
KOG4555|consensus175 98.42
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.4
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.36
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.33
PF1343134 TPR_17: Tetratricopeptide repeat 98.33
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.33
KOG1585|consensus308 98.31
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.31
KOG1586|consensus288 98.29
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.27
KOG2610|consensus491 98.26
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.24
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.22
KOG4642|consensus284 98.21
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.19
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.16
KOG4642|consensus284 98.16
KOG4507|consensus 886 98.15
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.13
KOG0530|consensus318 98.13
PF1342844 TPR_14: Tetratricopeptide repeat 98.06
PF13281374 DUF4071: Domain of unknown function (DUF4071) 98.05
COG2976207 Uncharacterized protein conserved in bacteria [Fun 98.05
KOG2300|consensus629 98.04
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.02
COG3118304 Thioredoxin domain-containing protein [Posttransla 98.01
KOG3616|consensus 1636 98.01
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 98.0
KOG0545|consensus329 98.0
KOG0376|consensus 476 98.0
KOG2610|consensus491 97.99
PF1343134 TPR_17: Tetratricopeptide repeat 97.98
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.96
KOG0551|consensus390 97.94
KOG3616|consensus 1636 97.93
KOG0376|consensus476 97.92
KOG0551|consensus390 97.91
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.91
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.9
KOG0545|consensus329 97.89
KOG0530|consensus318 97.88
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.81
KOG1550|consensus552 97.79
KOG1550|consensus552 97.78
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.78
KOG1258|consensus577 97.75
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.75
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.72
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.7
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.69
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.68
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.66
KOG1914|consensus656 97.62
KOG4507|consensus886 97.54
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.53
KOG1308|consensus 377 97.51
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.5
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.49
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.49
KOG0985|consensus 1666 97.49
COG4649221 Uncharacterized protein conserved in bacteria [Fun 97.49
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.43
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.42
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.41
KOG3783|consensus546 97.35
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.32
KOG1308|consensus377 97.3
KOG1258|consensus577 97.28
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.27
KOG3824|consensus 472 97.23
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.19
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 97.17
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.16
KOG0985|consensus 1666 97.09
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.08
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 97.05
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.04
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.01
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.97
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.94
KOG2041|consensus1189 96.91
KOG1464|consensus440 96.85
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.81
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.79
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.71
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.69
PRK10941269 hypothetical protein; Provisional 96.68
KOG0890|consensus 2382 96.65
PRK10941269 hypothetical protein; Provisional 96.62
KOG2396|consensus 568 96.62
KOG1464|consensus440 96.61
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.57
KOG0890|consensus 2382 96.52
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.47
COG4976 287 Predicted methyltransferase (contains TPR repeat) 96.45
KOG2396|consensus 568 96.32
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 96.22
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.2
KOG3824|consensus472 96.17
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.13
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.07
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 96.05
KOG3364|consensus149 96.04
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.01
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 96.0
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.99
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 95.97
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 95.92
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.85
KOG3364|consensus149 95.76
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.63
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 95.57
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.51
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.45
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 95.31
KOG2422|consensus665 95.24
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 95.22
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 95.14
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.0
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 94.98
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 94.97
COG5191435 Uncharacterized conserved protein, contains HAT (H 94.97
KOG1310|consensus758 94.94
KOG1839|consensus1236 94.89
KOG2422|consensus665 94.89
COG1747 711 Uncharacterized N-terminal domain of the transcrip 94.83
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.83
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.79
KOG1310|consensus758 94.66
KOG2581|consensus493 94.61
KOG2041|consensus1189 94.52
KOG4814|consensus872 94.52
COG2912269 Uncharacterized conserved protein [Function unknow 94.44
COG4976287 Predicted methyltransferase (contains TPR repeat) 94.38
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 94.3
COG5191435 Uncharacterized conserved protein, contains HAT (H 94.24
KOG1463|consensus411 94.22
COG5159421 RPN6 26S proteasome regulatory complex component [ 94.13
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 94.06
KOG4814|consensus 872 93.9
KOG0128|consensus 881 93.85
PF1286294 Apc5: Anaphase-promoting complex subunit 5 93.79
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.68
KOG0529|consensus421 93.61
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 93.54
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.52
KOG1538|consensus1081 93.46
KOG3807|consensus556 93.17
KOG1538|consensus1081 93.14
KOG0529|consensus421 93.12
COG2912269 Uncharacterized conserved protein [Function unknow 93.09
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.86
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 92.56
KOG3783|consensus546 92.09
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 91.92
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 91.9
KOG1463|consensus411 91.66
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 91.65
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 91.58
COG5159421 RPN6 26S proteasome regulatory complex component [ 91.38
KOG3807|consensus556 91.33
KOG1839|consensus1236 91.33
COG1747 711 Uncharacterized N-terminal domain of the transcrip 91.18
COG3629280 DnrI DNA-binding transcriptional activator of the 90.96
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 90.56
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 90.37
COG3629280 DnrI DNA-binding transcriptional activator of the 89.45
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 89.41
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 89.28
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 89.24
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 89.15
PRK11619 644 lytic murein transglycosylase; Provisional 88.86
COG4941415 Predicted RNA polymerase sigma factor containing a 88.59
KOG2114|consensus 933 88.44
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 87.94
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 87.93
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 87.7
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 87.13
KOG0546|consensus372 86.84
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 85.88
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 85.88
PF1285434 PPR_1: PPR repeat 85.65
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 85.18
KOG0128|consensus 881 85.15
PHA02537230 M terminase endonuclease subunit; Provisional 84.67
COG4455 273 ImpE Protein of avirulence locus involved in tempe 84.67
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 84.48
COG4455273 ImpE Protein of avirulence locus involved in tempe 84.24
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 84.05
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 83.9
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 83.84
COG3947361 Response regulator containing CheY-like receiver a 83.78
PF1285434 PPR_1: PPR repeat 83.68
KOG0686|consensus466 82.62
KOG2581|consensus493 81.53
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 80.74
KOG2063|consensus877 80.73
COG5536328 BET4 Protein prenyltransferase, alpha subunit [Pos 80.42
COG3947361 Response regulator containing CheY-like receiver a 80.37
>KOG4626|consensus Back     alignment and domain information
Probab=100.00  E-value=3.3e-46  Score=338.37  Aligned_cols=387  Identities=17%  Similarity=0.173  Sum_probs=347.0

Q ss_pred             chHHHHHHHHHHHhhhcHHHHHHHHHHHhhcCCCchhHHHHHHHHHHHHHHhCCchHHHHHHHHHhhcCCCCchhHHHHH
Q psy12713         60 HELDLLSKAKRAFEHEDYLTAIRHCTEEIESTSSNHTKALARLLRATVYIFTSQSTKAIEDLTQLVEDTSVDPKIKVNAH  139 (551)
Q Consensus        60 ~~~~~~~~a~~~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~  139 (551)
                      -.+.+-..|..+-..|++++|+..|+.+++..|+   ..++|.++|.++...|+.+.|..+|..+++++|+...    +.
T Consensus       115 ~ae~ysn~aN~~kerg~~~~al~~y~~aiel~p~---fida~inla~al~~~~~~~~a~~~~~~alqlnP~l~c----a~  187 (966)
T KOG4626|consen  115 GAEAYSNLANILKERGQLQDALALYRAAIELKPK---FIDAYINLAAALVTQGDLELAVQCFFEALQLNPDLYC----AR  187 (966)
T ss_pred             HHHHHHHHHHHHHHhchHHHHHHHHHHHHhcCch---hhHHHhhHHHHHHhcCCCcccHHHHHHHHhcCcchhh----hh
Confidence            4677788999999999999999999999999999   9999999999999999999999999999999998744    44


Q ss_pred             HHHHHHHHHhcCCHHHHHHHHHHHHhcCCCChhHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhh
Q psy12713        140 IKRAVVHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVVHKMI  219 (551)
Q Consensus       140 ~~la~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~~l~~~~~~~~~~~~~~~~~~~~~  219 (551)
                      ..+|..+...| +..+|..+|.++++..|..+.+|.++|.++..+|+...|+..|+++++++|+..++++++|.++-.. 
T Consensus       188 s~lgnLlka~G-rl~ea~~cYlkAi~~qp~fAiawsnLg~~f~~~Gei~~aiq~y~eAvkldP~f~dAYiNLGnV~ke~-  265 (966)
T KOG4626|consen  188 SDLGNLLKAEG-RLEEAKACYLKAIETQPCFAIAWSNLGCVFNAQGEIWLAIQHYEEAVKLDPNFLDAYINLGNVYKEA-  265 (966)
T ss_pred             cchhHHHHhhc-ccchhHHHHHHHHhhCCceeeeehhcchHHhhcchHHHHHHHHHHhhcCCCcchHHHhhHHHHHHHH-
Confidence            55999999999 9999999999999999999999999999999999999999999999999999999999999777777 


Q ss_pred             cCCChhHHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHhccCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhcCCHHHH
Q psy12713        220 VPGDRERVEQSLKEFRNFVDTHSNVVEACTLFAQVLVDQEDFDGAEEYFNRSIRVDPENASLYVHRAMLMLQARGNVDEA  299 (551)
Q Consensus       220 ~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~A  299 (551)
                           +.++.|+.+|.+++...|++..++.++|.+|..+|..+-|+..|+++++..|+.+.++.++|.. +...|+..+|
T Consensus       266 -----~~~d~Avs~Y~rAl~lrpn~A~a~gNla~iYyeqG~ldlAI~~Ykral~~~P~F~~Ay~NlanA-Lkd~G~V~ea  339 (966)
T KOG4626|consen  266 -----RIFDRAVSCYLRALNLRPNHAVAHGNLACIYYEQGLLDLAIDTYKRALELQPNFPDAYNNLANA-LKDKGSVTEA  339 (966)
T ss_pred             -----hcchHHHHHHHHHHhcCCcchhhccceEEEEeccccHHHHHHHHHHHHhcCCCchHHHhHHHHH-HHhccchHHH
Confidence                 9999999999999999999999999999999999999999999999999999999999999999 5559999999


Q ss_pred             HHHHHHHHhcCcCCHHHHHHHHHHHHHhCCHHHHHHHHHHhcccccCHHHHHHHHhHHHHHHHHHHHHHHhccccCCCcc
Q psy12713        300 IKLIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAAIAQMKVCERYNIKKKVSPR  379 (551)
Q Consensus       300 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  379 (551)
                      ..+|.+++...|+.+.+..+||.++..+|.+++|...|.++++..|........++....                    
T Consensus       340 ~~cYnkaL~l~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v~p~~aaa~nNLa~i~k--------------------  399 (966)
T KOG4626|consen  340 VDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEVFPEFAAAHNNLASIYK--------------------  399 (966)
T ss_pred             HHHHHHHHHhCCccHHHHHHHHHHHHHhccchHHHHHHHHHHhhChhhhhhhhhHHHHHH--------------------
Confidence            999999999999999999999999999999999999999999999987776555443300                    


Q ss_pred             hhhhhHHHHHHHHHHhhchhhhccccCCCCCccccCcchhhHHHHhhhccCCccccCCCcchhhhhhhhhccchhhhch-
Q psy12713        380 SQNITKNEKLAIKQLRENNDIIIRPADKGGKTVVMDKADYTQKMTSILNSNDYEIIPGDPTKTIEESEKYGNLENESGQ-  458 (551)
Q Consensus       380 ~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-  458 (551)
                                                         ..+.+.+++             ..+..++.+.+.+...+...|. 
T Consensus       400 -----------------------------------qqgnl~~Ai-------------~~YkealrI~P~fAda~~NmGnt  431 (966)
T KOG4626|consen  400 -----------------------------------QQGNLDDAI-------------MCYKEALRIKPTFADALSNMGNT  431 (966)
T ss_pred             -----------------------------------hcccHHHHH-------------HHHHHHHhcCchHHHHHHhcchH
Confidence                                               011111111             1222344455666666666666 


Q ss_pred             hhhhcChhHHHHhhHHhhccCCCchHHHhhhhhHHHHhcCHHHHHHHHHHHhhcCCchHHHHHHHHHHHHH
Q psy12713        459 KHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVWTS  529 (551)
Q Consensus       459 ~~~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~  529 (551)
                      +...|+.+.|+..|.+++..+|..++++.+||.+|...|+..+|+..|+.+++++|++++++.++..++.-
T Consensus       432 ~ke~g~v~~A~q~y~rAI~~nPt~AeAhsNLasi~kDsGni~~AI~sY~~aLklkPDfpdA~cNllh~lq~  502 (966)
T KOG4626|consen  432 YKEMGDVSAAIQCYTRAIQINPTFAEAHSNLASIYKDSGNIPEAIQSYRTALKLKPDFPDAYCNLLHCLQI  502 (966)
T ss_pred             HHHhhhHHHHHHHHHHHHhcCcHHHHHHhhHHHHhhccCCcHHHHHHHHHHHccCCCCchhhhHHHHHHHH
Confidence            88899999999999999999999999999999999999999999999999999999999999999988765



>KOG4626|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1914|consensus Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0530|consensus Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>KOG0530|consensus Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1258|consensus Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1914|consensus Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG3783|consensus Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>KOG1258|consensus Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG1464|consensus Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG0890|consensus Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG2396|consensus Back     alignment and domain information
>KOG1464|consensus Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG0890|consensus Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2396|consensus Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG2422|consensus Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1839|consensus Back     alignment and domain information
>KOG2422|consensus Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG2581|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG1463|consensus Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0529|consensus Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG3807|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0529|consensus Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG3783|consensus Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG1463|consensus Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3807|consensus Back     alignment and domain information
>KOG1839|consensus Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG0546|consensus Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG0686|consensus Back     alignment and domain information
>KOG2581|consensus Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG2063|consensus Back     alignment and domain information
>COG5536 BET4 Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query551
2gw1_A514 Crystal Structure Of The Yeast Tom70 Length = 514 6e-13
3fp2_A537 Crystal Structure Of Tom71 Complexed With Hsp82 C-T 9e-09
3lca_A533 Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term 9e-09
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 3e-08
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 3e-07
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 2e-06
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 2e-05
2q7f_A243 Crystal Structure Of Yrrb: A Tpr Protein With An Un 2e-04
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 3e-04
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 4e-04
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 4e-04
3ieg_A359 Crystal Structure Of P58(Ipk) Tpr Domain At 2.5 A L 5e-04
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 9e-04
>pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70 Length = 514 Back     alignment and structure

Iteration: 1

Score = 72.4 bits (176), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 66/250 (26%), Positives = 120/250 (48%), Gaps = 15/250 (6%) Query: 135 KVNAHIKRAVVHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNL 194 +VN++I A++ + +D T+ + D+A K+D N + YY RGQ+ + Y++A ++ Sbjct: 269 RVNSYIYMALI-MADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDF 327 Query: 195 DKTIALNPNFHVARAQRHFVVHKMIVPGDRERVEQSLKEFRNFVDTHSNVVEACTLFAQV 254 DK L+P Q + ++ D E + K R F + E FA++ Sbjct: 328 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAK--RKFPEAP----EVPNFFAEI 381 Query: 255 LVDQEDFDGAEEYFNRSIRVDPENASLYVHRAMLMLQAR--------GNVDEAIKLIEKA 306 L D+ DFD A + ++ +I ++ + +YV A L+ +A N EA L+EKA Sbjct: 382 LTDKNDFDKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKA 441 Query: 307 ISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAAIAQMKV 366 +D A L +++Q+ ++EA+ F ++ LAR E + +AA Q ++ Sbjct: 442 SKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRI 501 Query: 367 CERYNIKKKV 376 + KK+ Sbjct: 502 RSDPVLAKKI 511
>pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 Back     alignment and structure
>pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 Back     alignment and structure
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2Q7F|A Chain A, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide- Binding Site Length = 243 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|3IEG|A Chain A, Crystal Structure Of P58(Ipk) Tpr Domain At 2.5 A Length = 359 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query551
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-62
2gw1_A514 Mitochondrial precursor proteins import receptor; 9e-31
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-28
2gw1_A 514 Mitochondrial precursor proteins import receptor; 4e-27
2gw1_A 514 Mitochondrial precursor proteins import receptor; 6e-21
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-08
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-56
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-30
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-30
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-21
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-20
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-08
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-08
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-05
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-41
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-39
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-37
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-30
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 5e-25
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-20
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-40
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-31
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-30
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-19
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-15
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-39
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-31
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 7e-20
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-33
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-31
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-28
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-28
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-28
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-26
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-24
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-23
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-23
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-23
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-08
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-32
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-32
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 7e-32
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-25
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-23
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-18
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-08
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-08
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-08
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 7e-08
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-08
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-08
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-07
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-07
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-30
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-21
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-20
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 8e-18
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-27
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-21
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-20
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-18
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 9e-12
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-07
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-07
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-27
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 7e-25
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-19
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-08
2q7f_A 243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-08
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-08
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-08
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-07
2q7f_A 243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 5e-27
4g1t_A472 Interferon-induced protein with tetratricopeptide 4e-24
4g1t_A472 Interferon-induced protein with tetratricopeptide 7e-21
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-20
4g1t_A472 Interferon-induced protein with tetratricopeptide 6e-10
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-26
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-17
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 9e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-26
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-18
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-14
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-07
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-26
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 5e-23
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-18
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 8e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-06
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 6e-05
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 4e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 8e-04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 4e-26
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-20
4eqf_A365 PEX5-related protein; accessory protein, tetratric 5e-18
4eqf_A365 PEX5-related protein; accessory protein, tetratric 5e-09
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-25
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-24
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-20
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 7e-20
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-18
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-25
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 9e-25
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 5e-20
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 9e-17
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-25
3u4t_A272 TPR repeat-containing protein; structural genomics 7e-25
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-24
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-20
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-09
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-08
3u4t_A 272 TPR repeat-containing protein; structural genomics 7e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-24
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-16
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-06
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 7e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 5e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-24
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-17
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-08
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-07
3as5_A 186 MAMA; tetratricopeptide repeats (TPR) containing p 6e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-23
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-21
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-19
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 6e-19
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 7e-23
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-20
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 6e-07
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-05
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 4e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 8e-05
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 6e-22
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-18
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-20
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 6e-19
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 5e-07
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 9e-06
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-04
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-04
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 8e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 9e-20
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-15
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 9e-14
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 7e-10
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 9e-08
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 9e-08
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 7e-05
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-17
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 3e-11
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 3e-06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-16
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-07
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-16
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-13
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-08
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-08
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 4e-06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-06
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 2e-16
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 3e-10
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 3e-09
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 4e-07
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 2e-05
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 4e-05
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 3e-15
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 3e-11
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-15
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-11
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 8e-05
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 6e-15
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 4e-09
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 4e-06
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 5e-05
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 8e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-14
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-11
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 5e-07
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-05
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 6e-14
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 9e-09
1hh8_A 213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 5e-08
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 7e-14
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-10
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-08
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 9e-08
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-07
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-05
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 3e-13
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 7e-08
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 3e-05
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 3e-04
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 5e-04
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 3e-13
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 3e-12
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 6e-10
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 3e-06
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 4e-13
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 1e-11
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-09
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-08
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 8e-08
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-07
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-04
2kat_A115 Uncharacterized protein; NESG, structure, structur 6e-13
2kat_A115 Uncharacterized protein; NESG, structure, structur 8e-10
2kat_A115 Uncharacterized protein; NESG, structure, structur 7e-08
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-07
2kat_A115 Uncharacterized protein; NESG, structure, structur 7e-06
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-05
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 2e-12
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 3e-05
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 4e-04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-12
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 5e-12
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 5e-10
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-09
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-09
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-07
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-07
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-06
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 4e-12
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 6e-09
3q49_B137 STIP1 homology and U box-containing protein 1; E3 4e-12
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-05
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-04
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-11
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-06
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 5e-06
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 5e-06
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 6e-06
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 9e-06
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 5e-05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-11
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-11
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-06
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 3e-11
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 7e-07
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 5e-05
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 9e-05
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 4e-04
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 4e-11
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 3e-05
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 7e-05
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 1e-04
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 5e-11
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 8e-08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-07
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-05
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 5e-11
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-06
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 7e-06
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-05
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 6e-05
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 8e-05
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 1e-04
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 5e-11
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-06
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 7e-06
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 6e-04
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 6e-04
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 5e-11
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 1e-05
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 1e-04
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 5e-11
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 8e-06
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 3e-05
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-04
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 3e-04
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-10
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-08
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 4e-07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 7e-07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-10
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-10
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 7e-10
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 5e-09
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 9e-07
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-09
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-08
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-09
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-09
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 4e-09
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 5e-09
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-07
2l6j_A111 TPR repeat-containing protein associated with HSP; 5e-09
2l6j_A111 TPR repeat-containing protein associated with HSP; 4e-04
2l6j_A111 TPR repeat-containing protein associated with HSP; 7e-04
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 1e-08
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-06
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 1e-05
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-08
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-08
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 3e-07
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 6e-06
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-08
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-07
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 3e-07
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 4e-07
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-05
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 3e-08
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 1e-05
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 2e-05
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 2e-07
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 6e-07
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 3e-06
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-05
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 2e-05
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-07
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 6e-07
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-06
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 4e-06
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 7e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-07
3k9i_A117 BH0479 protein; putative protein binding protein, 9e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 9e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 8e-04
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 2e-06
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 6e-04
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 3e-06
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-05
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 4e-06
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 4e-06
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 2e-04
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 6e-06
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 3e-04
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 7e-06
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 6e-04
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 4e-05
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 4e-04
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 4e-05
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 9e-05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 5e-05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 8e-05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 6e-04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 1e-04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 6e-04
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-04
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 1e-04
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 8e-04
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
 Score =  211 bits (538), Expect = 7e-62
 Identities = 79/383 (20%), Positives = 152/383 (39%), Gaps = 26/383 (6%)

Query: 7   AQHAKEEISKRSFFKPSKQFIKTYLKSFPNDPILQPDGLSNGVELTNGDTNESHELDLLS 66
           +    +E   +    PS   + ++   F  +            E      N    L   S
Sbjct: 144 STQPAKERKDKQENLPSVTSMASFFGIFKPELTFAN--YDESNEADKELMNGLSNLYKRS 201

Query: 67  KAKRAFEHEDYLTAIRHCTEEIESTSS----NHTKALARLLRATVYIFTSQSTKAIEDLT 122
                   E +  A R   E+++  +         A++           +    A ED+ 
Sbjct: 202 PESYDKADESFTKAARLFEEQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIK 261

Query: 123 QLVEDTSVDPKIKVNAHIKRAVVHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYC 182
           + +E   + P++  N++I  A++     +D T+ +   D+A K+D N +  YY RGQ+  
Sbjct: 262 KAIE---LFPRV--NSYIYMALIMADR-NDSTEYYNYFDKALKLDSNNSSVYYHRGQMNF 315

Query: 183 LFGQYEEALRNLDKTIALNPNFHVARAQRHFVVHKMIVPGDRERVEQSLKEFRNFVDTHS 242
           +   Y++A ++ DK   L+P       Q   + ++        + +     F        
Sbjct: 316 ILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRE------NKFDDCETLFSEAKRKFP 369

Query: 243 NVVEACTLFAQVLVDQEDFDGAEEYFNRSIRVDPENASLYVHRAMLMLQAR--------G 294
              E    FA++L D+ DFD A + ++ +I ++ +   +YV  A L+ +A          
Sbjct: 370 EAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVE 429

Query: 295 NVDEAIKLIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIY 354
           N  EA  L+EKA  +D     A   L  +++Q+  ++EA+  F ++  LAR   E     
Sbjct: 430 NFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAI 489

Query: 355 SLRDAAIAQMKVCERYNIKKKVS 377
           +  +AA  Q ++     + KK+ 
Sbjct: 490 TFAEAAKVQQRIRSDPVLAKKIQ 512


>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Length = 306 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Length = 273 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Length = 273 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query551
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
4g1t_A472 Interferon-induced protein with tetratricopeptide 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 100.0
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 100.0
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 100.0
4g1t_A472 Interferon-induced protein with tetratricopeptide 100.0
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 100.0
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.98
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.97
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.97
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.97
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.97
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.97
3u4t_A272 TPR repeat-containing protein; structural genomics 99.97
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.97
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.96
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.96
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.96
3u4t_A272 TPR repeat-containing protein; structural genomics 99.95
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.95
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.95
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.95
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.95
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.95
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.94
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.94
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.94
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.94
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.94
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.94
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.94
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.93
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.93
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.93
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.93
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.92
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.92
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.92
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.92
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.92
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.92
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.92
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.92
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.92
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.92
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.91
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.91
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.91
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.91
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.9
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.89
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.89
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.89
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.88
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.88
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.88
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.88
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.88
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.87
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.87
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.87
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.86
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.86
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.85
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.85
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.85
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.84
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.84
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.84
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.84
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.84
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.83
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.83
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.83
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.83
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.83
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.83
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.82
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.82
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.82
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.81
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.81
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.81
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.81
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.8
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.79
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.77
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.77
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.77
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.76
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.76
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.75
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.75
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.75
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.72
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.72
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.72
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.72
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.72
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.72
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.71
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.69
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.69
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.69
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.69
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.69
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.68
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.68
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.68
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.67
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.66
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.66
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.66
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.64
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.64
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.64
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.63
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.62
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.62
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.61
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.59
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.59
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.58
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.58
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.58
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.57
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.57
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.57
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.56
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.56
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.55
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.55
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.55
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.54
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.54
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.54
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.53
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.53
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.53
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.53
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.53
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.52
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.52
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.51
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.5
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.49
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.49
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.49
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.48
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.48
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.48
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.47
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.47
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.46
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.45
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.45
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.44
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.44
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.44
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.43
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.43
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.42
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.42
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.41
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.41
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.4
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.4
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.38
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.38
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.37
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.37
3k9i_A117 BH0479 protein; putative protein binding protein, 99.36
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.35
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.35
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.35
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.33
3k9i_A117 BH0479 protein; putative protein binding protein, 99.32
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.32
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.3
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.19
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.19
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.16
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.15
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.14
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.02
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.01
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.98
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.97
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.97
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.94
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.91
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.91
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.89
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.86
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.8
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.73
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.73
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.65
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.62
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.59
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.57
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.55
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.45
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.41
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 98.38
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.34
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 98.3
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.2
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.04
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.01
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.96
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.8
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.47
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.44
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.42
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.4
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.34
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 97.0
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 96.53
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 96.48
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.31
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.3
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 96.29
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.26
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.22
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 96.16
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 96.12
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 95.97
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 95.82
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.63
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 95.53
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 95.48
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.16
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.15
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 95.09
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.66
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 94.55
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 94.51
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 94.1
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 94.05
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 93.78
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 93.46
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 93.05
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 92.96
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 91.49
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.05
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 90.81
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 87.51
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 86.76
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 82.54
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 80.32
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=100.00  E-value=3.8e-44  Score=344.87  Aligned_cols=385  Identities=16%  Similarity=0.202  Sum_probs=332.7

Q ss_pred             HHHHHHHhhhcHHHHHHHHHHHhhcCCCchhHHHHHHHHHHHHHHhCCchHHHHHHHHHhhcCCCCchhHHHHHHHHHHH
Q psy12713         66 SKAKRAFEHEDYLTAIRHCTEEIESTSSNHTKALARLLRATVYIFTSQSTKAIEDLTQLVEDTSVDPKIKVNAHIKRAVV  145 (551)
Q Consensus        66 ~~a~~~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~la~~  145 (551)
                      ..|..++..|++++|+..+.++++.+|+   ++.++..+|.++...|++++|+..++++++.+|.+    ..++..+|.+
T Consensus         4 ~~a~~~~~~g~~~~A~~~~~~~~~~~p~---~~~~~~~l~~~~~~~~~~~~a~~~~~~a~~~~p~~----~~~~~~lg~~   76 (388)
T 1w3b_A            4 ELAHREYQAGDFEAAERHCMQLWRQEPD---NTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLL----AEAYSNLGNV   76 (388)
T ss_dssp             THHHHHHHHTCHHHHHHHHHHHHHHCTT---CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTC----HHHHHHHHHH
T ss_pred             hHHHHHHHCCCHHHHHHHHHHHHHhCCC---CHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCc----hHHHHHHHHH
Confidence            4688899999999999999999999998   88999999999999999999999999999999988    4467779999


Q ss_pred             HHHhcCCHHHHHHHHHHHHhcCCCChhHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhhcCCChh
Q psy12713        146 HLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVVHKMIVPGDRE  225 (551)
Q Consensus       146 ~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~  225 (551)
                      +...| ++++|+..|++++..+|+++.++..+|.++...|++++|+..|+++++.+|+....+..++.++...      |
T Consensus        77 ~~~~g-~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~------g  149 (388)
T 1w3b_A           77 YKERG-QLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKAL------G  149 (388)
T ss_dssp             HHHHT-CHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTT------S
T ss_pred             HHHCC-CHHHHHHHHHHHHHcCcchHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHc------c
Confidence            99999 9999999999999999999999999999999999999999999999999999999999999777766      9


Q ss_pred             HHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHhccCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhcCCHHHHHHHHHH
Q psy12713        226 RVEQSLKEFRNFVDTHSNVVEACTLFAQVLVDQEDFDGAEEYFNRSIRVDPENASLYVHRAMLMLQARGNVDEAIKLIEK  305 (551)
Q Consensus       226 ~~~~A~~~~~~~~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~A~~~~~~  305 (551)
                      ++++|+..|++++..+|+++.++..+|.++...|++++|+..|+++++.+|++..++..+|.++.. .|++++|+..+++
T Consensus       150 ~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~-~~~~~~A~~~~~~  228 (388)
T 1w3b_A          150 RLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKE-ARIFDRAVAAYLR  228 (388)
T ss_dssp             CHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHT-TTCTTHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHH-cCCHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999999776 9999999999999


Q ss_pred             HHhcCcCCHHHHHHHHHHHHHhCCHHHHHHHHHHhcccccCHHHHHHHHhHHHHHHHHHHHHHHhccccCCCcchhhhhH
Q psy12713        306 AISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAELSHIYSLRDAAIAQMKVCERYNIKKKVSPRSQNITK  385 (551)
Q Consensus       306 ~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  385 (551)
                      ++..+|+++.++..+|.++...|++++|+..|+++++..|+++..+..++......                       +
T Consensus       229 al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~-----------------------g  285 (388)
T 1w3b_A          229 ALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEK-----------------------G  285 (388)
T ss_dssp             HHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHH-----------------------S
T ss_pred             HHhhCcCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHc-----------------------C
Confidence            99999999999999999999999999999999999999999887655444331110                       1


Q ss_pred             HHHHHHHHHhhchhhhccccCCCCCccccCcchhhHHHHhhhccCCccccCCCcchhhhhhhhhccchhhhchhhhhcCh
Q psy12713        386 NEKLAIKQLRENNDIIIRPADKGGKTVVMDKADYTQKMTSILNSNDYEIIPGDPTKTIEESEKYGNLENESGQKHAASDF  465 (551)
Q Consensus       386 ~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  465 (551)
                      ....++..+.+...                                  ..|.+..          .+...+..+...|++
T Consensus       286 ~~~~A~~~~~~al~----------------------------------~~p~~~~----------~~~~l~~~~~~~g~~  321 (388)
T 1w3b_A          286 SVAEAEDCYNTALR----------------------------------LCPTHAD----------SLNNLANIKREQGNI  321 (388)
T ss_dssp             CHHHHHHHHHHHHH----------------------------------HCTTCHH----------HHHHHHHHHHTTTCH
T ss_pred             CHHHHHHHHHHHHh----------------------------------hCcccHH----------HHHHHHHHHHHcCCH
Confidence            11122222221100                                  0111111          112223336778999


Q ss_pred             hHHHHhhHHhhccCCCchHHHhhhhhHHHHhcCHHHHHHHHHHHhhcCCchHHHHHHHHHHHHHhhh
Q psy12713        466 TKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFHVARAQRHFVWTSTLA  532 (551)
Q Consensus       466 ~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~~~  532 (551)
                      ++|+..++++++.+|+++.+++.+|.++...|++++|+..|+++++++|+++.++.++|.++..+|+
T Consensus       322 ~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~~p~~~~a~~~lg~~~~~~~~  388 (388)
T 1w3b_A          322 EEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHhcCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHhHHHHHHHccC
Confidence            9999999999999999999999999999999999999999999999999999999999999987653



>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 551
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-23
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-22
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-21
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-17
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-16
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-09
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-15
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-11
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-10
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-04
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-13
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-10
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 5e-10
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 4e-08
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-05
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-12
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-10
d1xnfa_ 259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-04
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 7e-12
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-10
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 3e-04
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 9e-12
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 2e-09
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 5e-07
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 3e-11
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 3e-08
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 3e-04
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 0.002
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 5e-11
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 7e-07
d2h6fa1 315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 0.004
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 2e-10
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 4e-09
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 3e-07
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 7e-06
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 4e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-09
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-07
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 9e-08
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 3e-04
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 1e-07
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 1e-06
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 8e-04
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-07
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 4e-05
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 4e-04
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 4e-04
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 7e-05
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 0.002
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 1e-04
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 2e-04
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 0.001
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 98.6 bits (244), Expect = 6e-23
 Identities = 42/204 (20%), Positives = 98/204 (48%), Gaps = 7/204 (3%)

Query: 146 HLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTIALNPNFH 205
             +A  +   A    ++A  +DPN  D+Y   G +      ++ A+    + ++L+PN  
Sbjct: 178 VFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHA 237

Query: 206 VARAQRHFVVHKMIVPGDRERVEQSLKEFRNFVDTHSNVVEACTLFAQVLVDQEDFDGAE 265
           V       V ++         ++ ++  +R  ++   +  +A    A  L ++     AE
Sbjct: 238 VVHGNLACVYYEQ------GLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAE 291

Query: 266 EYFNRSIRVDPENASLYVHRAMLMLQARGNVDEAIKLIEKAISIDKSCMFAYETLGTIEV 325
           + +N ++R+ P +A    + A +  + +GN++EA++L  KA+ +      A+  L ++  
Sbjct: 292 DCYNTALRLCPTHADSLNNLANI-KREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQ 350

Query: 326 QRGRLEEAVKCFNKALPLARDEAE 349
           Q+G+L+EA+  + +A+ ++   A+
Sbjct: 351 QQGKLQEALMHYKEAIRISPTFAD 374


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query551
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.97
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.97
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.92
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.92
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.91
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.9
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.89
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.89
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.85
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.83
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.68
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.68
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.67
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.67
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.67
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.67
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.66
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.64
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.62
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.6
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.55
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.54
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.53
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.52
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.51
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.51
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.5
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.49
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.49
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.49
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.48
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.47
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.46
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.46
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.46
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.45
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.39
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.2
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.15
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.12
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.1
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.95
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.93
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.81
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.79
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.48
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.3
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 98.17
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.04
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.99
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.3
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.29
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 95.46
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 87.08
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 82.92
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1e-40  Score=318.56  Aligned_cols=352  Identities=21%  Similarity=0.268  Sum_probs=279.0

Q ss_pred             HHHHHHHHhhhcHHHHHHHHHHHhhcCCCchhHHHHHHHHHHHHHHhCCchHHHHHHHHHhhcCCCCchhHHHHHHHHHH
Q psy12713         65 LSKAKRAFEHEDYLTAIRHCTEEIESTSSNHTKALARLLRATVYIFTSQSTKAIEDLTQLVEDTSVDPKIKVNAHIKRAV  144 (551)
Q Consensus        65 ~~~a~~~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~la~  144 (551)
                      +..|..+++.|+|++|+..|+++++.+|+   ++.++..+|.++...|++++|+..++++++.+|++    ..++..+|.
T Consensus         3 l~la~~~~~~G~~~~A~~~~~~~l~~~p~---~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~----~~a~~~l~~   75 (388)
T d1w3ba_           3 MELAHREYQAGDFEAAERHCMQLWRQEPD---NTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLL----AEAYSNLGN   75 (388)
T ss_dssp             CTHHHHHHHHTCHHHHHHHHHHHHHHCTT---CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTC----HHHHHHHHH
T ss_pred             HHHHHHHHHcCCHHHHHHHHHHHHHhCCC---CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCC----HHHHHHHHH
Confidence            56899999999999999999999999998   89999999999999999999999999999999998    456777999


Q ss_pred             HHHHhcCCHHHHHHHHHHHHhcCCCChhHHHHHHHHHHHh----------------------------------CCHHHH
Q psy12713        145 VHLHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLF----------------------------------GQYEEA  190 (551)
Q Consensus       145 ~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~la~~~~~~----------------------------------~~~~~A  190 (551)
                      ++...| ++++|+..+..+....|.........+......                                  +....+
T Consensus        76 ~~~~~g-~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  154 (388)
T d1w3ba_          76 VYKERG-QLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEA  154 (388)
T ss_dssp             HHHHHT-CHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHH
T ss_pred             Hhhhhc-cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhh
Confidence            999999 999999999999999888766555555444444                                  445555


Q ss_pred             HHHHHHHHhcCCCCHHHHHHHHHHHHHhhcCCChhHHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHhccCHHHHHHHHHH
Q psy12713        191 LRNLDKTIALNPNFHVARAQRHFVVHKMIVPGDRERVEQSLKEFRNFVDTHSNVVEACTLFAQVLVDQEDFDGAEEYFNR  270 (551)
Q Consensus       191 ~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~  270 (551)
                      ...+.+.+...|+....+..++..+...      |++++|...+++++..+|+++.++..+|.++...|++++|+..+++
T Consensus       155 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~------~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~  228 (388)
T d1w3ba_         155 KACYLKAIETQPNFAVAWSNLGCVFNAQ------GEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLR  228 (388)
T ss_dssp             HHHHHHHHHHCTTCHHHHHHHHHHHHTT------TCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHH
T ss_pred             HHHHHHhhccCcchhHHHHhhccccccc------CcHHHHHHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHH
Confidence            5566666666666666666666555544      6677777777777777777777777777777777777777777777


Q ss_pred             HHhcCCCCHHHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCcCCHHHHHHHHHHHHHhCCHHHHHHHHHHhcccccCHHHH
Q psy12713        271 SIRVDPENASLYVHRAMLMLQARGNVDEAIKLIEKAISIDKSCMFAYETLGTIEVQRGRLEEAVKCFNKALPLARDEAEL  350 (551)
Q Consensus       271 ~~~~~~~~~~~~~~l~~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~~~~~~~~  350 (551)
                      +....|..+..+..+|.++.. .|++++|+..|+++++.+|+++.++..+|.++...|++++|+..+++++...|.+...
T Consensus       229 ~~~~~~~~~~~~~~l~~~~~~-~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~  307 (388)
T d1w3ba_         229 ALSLSPNHAVVHGNLACVYYE-QGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADS  307 (388)
T ss_dssp             HHHHCTTCHHHHHHHHHHHHH-TTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHH
T ss_pred             hHHHhhhHHHHHHHHHHHHHH-CCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchh
Confidence            776666666666667766555 6777777777777777777777777777777777777777777777666666665443


Q ss_pred             HHHHhHHHHHHHHHHHHHHhccccCCCcchhhhhHHHHHHHHHHhhchhhhccccCCCCCccccCcchhhHHHHhhhccC
Q psy12713        351 SHIYSLRDAAIAQMKVCERYNIKKKVSPRSQNITKNEKLAIKQLRENNDIIIRPADKGGKTVVMDKADYTQKMTSILNSN  430 (551)
Q Consensus       351 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  430 (551)
                      ...+                                                                            
T Consensus       308 ~~~l----------------------------------------------------------------------------  311 (388)
T d1w3ba_         308 LNNL----------------------------------------------------------------------------  311 (388)
T ss_dssp             HHHH----------------------------------------------------------------------------
T ss_pred             hhHH----------------------------------------------------------------------------
Confidence            2222                                                                            


Q ss_pred             CccccCCCcchhhhhhhhhccchhhhchhhhhcChhHHHHhhHHhhccCCCchHHHhhhhhHHHHhcCHHHHHHHHHHHh
Q psy12713        431 DYEIIPGDPTKTIEESEKYGNLENESGQKHAASDFTKAFADLDEAEKVDPNVADSYYQRGQIYCLFGQYEEALRNLDKTI  510 (551)
Q Consensus       431 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al  510 (551)
                                               +..+...|++++|+..|+++++.+|+++.+++.+|.++..+|++++|+.+|++++
T Consensus       312 -------------------------~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al  366 (388)
T d1w3ba_         312 -------------------------ANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAI  366 (388)
T ss_dssp             -------------------------HHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHH
T ss_pred             -------------------------HHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHH
Confidence                                     1224556899999999999999999999999999999999999999999999999


Q ss_pred             hcCCchHHHHHHHHHHHHHhhh
Q psy12713        511 ALNPNFHVARAQRHFVWTSTLA  532 (551)
Q Consensus       511 ~~~p~~~~a~~~l~~~~~~~~~  532 (551)
                      +++|+++.++.++|.+|.++||
T Consensus       367 ~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         367 RISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             TTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HhCCCCHHHHHHHHHHHHHcCC
Confidence            9999999999999999998875



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure