Diaphorina citri psyllid: psy12734

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------
MSKYVGAMTERQKLQEETDIMMRRLEAADKLISGLGREKIRWTADLATLEQNRNQLIGACLLSGAFLCYTSAFTWEFRQQMVYVDWQSNITKLSIPIVSDFRLEKELCDDVMISQWNSEGLPPDELSIQNGILSTRGCHFPLCIDPQTQALKWIRNREDKNNLKWNSEGLPPDELSIQNGILSTRGCHFPLCIDPQTQALKWIRNREDKNNPKVNQP
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHccHHcccccccccccHHHHHccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHccECcccccccccc
*SKYV*AMTERQKLQEETDIMMRRLEAADKLISGLGREKIRWTADLATLEQNRNQLIGACLLSGAFLCYTSAFTWEFRQQMVYVDWQSNITKLSIPIVSDFRLEKELCDDVMISQWNSEGLPPDELSIQNGILSTRGCHFPLCIDPQTQALKWIRNREDKNNLKWNSEGLPPDELSIQNGILSTRGCHFPLCIDPQTQALKWIRNRED*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKYVGAMTExxxxxxxxxxxxxxxxxxxxxISGLGREKIRWTADLATLEQNRNQLIGACLLSGAFLCYTSAFTWEFRQQMVYVDWQSNITKLSIPIVSDFRLEKELCDDVMISQWNSEGLPPDELSIQNGILSTRGCHFPLCIDPQTQALKWIRNREDKNNLKWNSEGLPPDELSIQNGILSTRGCHFPLCIDPQTQALKWIRNREDKNNPKVNQP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dynein heavy chain 10, axonemal Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Involved in sperm motility; implicated in sperm flagellar assembly (By similarity). Probable inner arm dynein heavy chain.confidentQ8IVF4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035085 [CC]cilium axonemeprobableGO:0005737, GO:0005575, GO:0044463, GO:0043231, GO:0032838, GO:0031514, GO:0044441, GO:0044464, GO:0043229, GO:0005623, GO:0043226, GO:0044446, GO:0044444, GO:0097014, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0005930, GO:0044422, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IV1, chain A
Confidence level:probable
Coverage over the Query: 5-56
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3vkg, chain A very confident Alignment | Template Structure
3vkg, chain A very confident Alignment | Template Structure