Diaphorina citri psyllid: psy12738


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
VIAFDELKVDYKNPIDQCNSLNPLVLPEYLAHAIFNHNYVGNLRTYFTVFIPQYISTEGWIKLAFYLLSFFYYLYGYRNRPVMSGYGLYDPTSIMNADTLNKCQREGWIKLAFYLLSFFYYLYGSEFSYLSFFKDLTVIAFDELKVDYKNPIDQCNSLNPLVLPEYLAHAIFK
cCEEcccccccccHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccHHccccccccHHHHHHHHHcc
VIAFDELKVDYKNPIDQCNSLNPLVLPEYLAHAIFNHNYVGNLRTYFTVFIPQYISTEGWIKLAFYLLSFFYYLYGYRNRPVMSGYGLYDPTSIMNADTLNKCQREGWIKLAFYLLSFFYYLYGSEFSYLSFFKDLTVIAFDELKVDYKNPIDQCNSLNPLVLPEYLAHAIFK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VIAFDELKVDYKNPIDQCNSLNPLVLPEYLAHAIFNHNYVGNLRTYFTVFIPQYISTEGWIKLAFYLLSFFYYLYGYRNRPVMSGYGLYDPTSIMNADTLNKCQREGWIKLAFYLLSFFYYLYGSEFSYLSFFKDLTVIAFDELKVDYKNPIDQCNSLNPLVLPEYLAHAIFK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein cornichon homolog Involved in the selective transport and maturation of TGF-alpha family proteins.confidentO95406
Protein cornichon homolog Involved in the selective transport and maturation of TGF-alpha family proteins.confidentO35372
Protein cornichon homolog Involved in the selective transport and maturation of TGF-alpha family proteins.confidentQ5RDB5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0051668 [BP]localization within membraneprobableGO:0009987, GO:0008150, GO:0044763, GO:0051179, GO:0044699, GO:0051641
GO:0042391 [BP]regulation of membrane potentialprobableGO:0019725, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:2000311 [BP]regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activityprobableGO:0032879, GO:0032412, GO:0051049, GO:0009966, GO:0022898, GO:0023051, GO:0048583, GO:0050794, GO:0008150, GO:0032409, GO:0065007, GO:0034762, GO:0034765, GO:1900449, GO:0065009, GO:0010646, GO:0010469, GO:0050789, GO:0043269
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0014069 [CC]postsynaptic densityprobableGO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0032281 [CC]alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complexprobableGO:0043234, GO:0043235, GO:0032991, GO:0008328, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0035249 [BP]synaptic transmission, glutamatergicprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0007267, GO:0044763, GO:0023052, GO:0007268, GO:0007270, GO:0007154, GO:0044699, GO:0003008
GO:0016247 [MF]channel regulator activityprobableGO:0003674
GO:0043198 [CC]dendritic shaftprobableGO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted