Diaphorina citri psyllid: psy12760


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MELEREHHEEIVEKKRRAIVTRPCSITSWMAVLSISDILSNSSIHTTPRSANTMAPASKWRSPVSGSDVTAAVRPTPELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYWLWLQNIY
ccHHHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHHHccccccccccHHcccccHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHccccCEEEEEcccccccccccEEEECccccccccccccccHHHHHHHHHHHHHHHHccccccccc
****************RAIVTRPCSITSWMAVLSISDILS**********************************PTPELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYWLWLQNI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELEREHHEEIVEKKRRAIVTRPCSITSWMAVLSISDILSNSSIHTTPRSANTMAPASKWRSPVSGSDVTAAVRPTPELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYWLWLQNIY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Structural maintenance of chromosomes protein 4 Central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. Also involved in chromosome segregation.confidentQ20060

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0000805 [CC]X chromosomeprobableGO:0043232, GO:0044464, GO:0000803, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0000775 [CC]chromosome, centromeric regionprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000070 [BP]mitotic sister chromatid segregationprobableGO:0006996, GO:0044699, GO:0000819, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0044763, GO:0022402, GO:0048285, GO:0007059, GO:0007067, GO:0007049, GO:0051276
GO:0000228 [CC]nuclear chromosomeprobableGO:0005575, GO:0031981, GO:0043232, GO:0043233, GO:0043227, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0005694, GO:0043226, GO:0044422, GO:0043231
GO:0030893 [CC]meiotic cohesin complexprobableGO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0000793, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0008278, GO:0044422
GO:0032116 [CC]SMC loading complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W1W, chain A
Confidence level:very confident
Coverage over the Query: 91-106,119-143,156-192
View the alignment between query and template
View the model in PyMOL