Psyllid ID: psy12760

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MELEREHHEEIVEKKRRAIVTRPCSITSWMAVLSISDILSNSSIHTTPRSANTMAPASKWRSPVSGSDVTAAVRPTPELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYWLWLQNIY
ccHHHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHHHccccccccccHHcccccHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHccccEEEEEEcccccccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHccccccccc
cccHHHHHHHHHHHHHccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccEEEEEcccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHcc
MELEREHHEEIVEKKRRAIVTRPCSITSWMAVLSISdilsnssihttprsantmapaskwrspvsgsdvtaavrptpelpvrDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFggkadleykeysdpyaqgikyvvrpprkswksidclsggEKTLASLALVFALHYYWLWLQNIY
melerehheeivekkrraivtrpcsITSWMAVLSISDILSNSSIHttprsantmapaskwrspvsgsdvtaavrptpelpvrdyAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYWLWLQNIY
MelerehheeivekkrrAIVTRPCSITSWMAVlsisdilsnssiHTTPRSANTMAPASKWRSPVSGSDVTAAVRPTPELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYWLWLQNIY
****************RAIVTRPCSITSWMAVLSISDILS**************************************************MQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYWLWLQNI*
**************************************************************************PTPELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYWLWLQ*I*
**********IVEKKRRAIVTRPCSITSWMAVLSISDILSNSSIHT*************************AVRPTPELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYWLWLQNIY
****REHHEEIVEKKRRAIVTRPCSITSWMAVLSISDILSNSSIHTTPRSANTMAPASKWRSPVSGSDVTAAVRPTPELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYWLWLQNIY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELEREHHEEIVEKKRRAIVTRPCSITSWMAVLSISDILSNSSIHTTPRSANTMAPASKWRSPVSGSDVTAAVRPTPELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYWLWLQNIY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query199 2.2.26 [Sep-21-2011]
Q9NTJ31288 Structural maintenance of yes N/A 0.542 0.083 0.481 4e-24
Q9ERA51243 Structural maintenance of N/A N/A 0.542 0.086 0.481 6e-23
Q8CG471286 Structural maintenance of yes N/A 0.542 0.083 0.481 7e-23
P505321290 Structural maintenance of N/A N/A 0.542 0.083 0.481 2e-22
Q54LV01415 Structural maintenance of yes N/A 0.552 0.077 0.463 4e-22
Q9FJL01241 Structural maintenance of yes N/A 0.603 0.096 0.443 1e-21
Q20060 1549 Structural maintenance of yes N/A 0.402 0.051 0.55 3e-20
P410041324 Structural maintenance of yes N/A 0.552 0.083 0.436 2e-18
Q122671418 Structural maintenance of yes N/A 0.557 0.078 0.423 3e-18
P48996 1469 Chromosome condensation p no N/A 0.402 0.054 0.506 1e-16
>sp|Q9NTJ3|SMC4_HUMAN Structural maintenance of chromosomes protein 4 OS=Homo sapiens GN=SMC4 PE=1 SV=2 Back     alignment and function desciption
 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 71/108 (65%)

Query: 84   YAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLE 143
            Y +R  E+  +    +++   YE    +R  EF   F  I  +++E YQMLT GG A+LE
Sbjct: 1103 YLQRVAELDKITYERDSFRQAYEDLRKQRLNEFMAGFYIITNKLKENYQMLTLGGDAELE 1162

Query: 144  YKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYY 191
              +  DP+++GI + VRPP+KSWK I  LSGGEKTL+SLALVFALH+Y
Sbjct: 1163 LVDSLDPFSEGIMFSVRPPKKSWKKIFNLSGGEKTLSSLALVFALHHY 1210
Central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.
Homo sapiens (taxid: 9606)
>sp|Q9ERA5|SMC4_MICAR Structural maintenance of chromosomes protein 4 (Fragment) OS=Microtus arvalis GN=SMC4 PE=2 SV=1 Back     alignment and function description
>sp|Q8CG47|SMC4_MOUSE Structural maintenance of chromosomes protein 4 OS=Mus musculus GN=Smc4 PE=1 SV=1 Back     alignment and function description
>sp|P50532|SMC4_XENLA Structural maintenance of chromosomes protein 4 OS=Xenopus laevis GN=smc4 PE=1 SV=1 Back     alignment and function description
>sp|Q54LV0|SMC4_DICDI Structural maintenance of chromosomes protein 4 OS=Dictyostelium discoideum GN=smc4 PE=3 SV=1 Back     alignment and function description
>sp|Q9FJL0|SMC4_ARATH Structural maintenance of chromosomes protein 4 OS=Arabidopsis thaliana GN=SMC4 PE=2 SV=1 Back     alignment and function description
>sp|Q20060|SMC4_CAEEL Structural maintenance of chromosomes protein 4 OS=Caenorhabditis elegans GN=smc-4 PE=1 SV=1 Back     alignment and function description
>sp|P41004|SMC4_SCHPO Structural maintenance of chromosomes protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut3 PE=1 SV=2 Back     alignment and function description
>sp|Q12267|SMC4_YEAST Structural maintenance of chromosomes protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC4 PE=1 SV=1 Back     alignment and function description
>sp|P48996|DPY27_CAEEL Chromosome condensation protein dpy-27 OS=Caenorhabditis elegans GN=dpy-27 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
198432135 1412 PREDICTED: similar to XCAP-C [Ciona inte 0.542 0.076 0.5 3e-24
15291771 550 LD25919p [Drosophila melanogaster] 0.542 0.196 0.481 9e-24
194884406 1409 GG20110 [Drosophila erecta] gi|190659438 0.542 0.076 0.481 1e-23
391326224 1422 PREDICTED: structural maintenance of chr 0.472 0.066 0.593 1e-23
348534713 1296 PREDICTED: structural maintenance of chr 0.542 0.083 0.490 2e-23
348534711 1286 PREDICTED: structural maintenance of chr 0.542 0.083 0.490 2e-23
6469332 1409 XCAP-C/SMC4 homolog Gluon [Drosophila me 0.542 0.076 0.481 2e-23
24584683 1409 gluon [Drosophila melanogaster] gi|60146 0.542 0.076 0.481 2e-23
195344564 1409 GM17160 [Drosophila sechellia] gi|194133 0.542 0.076 0.481 2e-23
195484008 1410 GE13167 [Drosophila yakuba] gi|194176625 0.542 0.076 0.481 2e-23
>gi|198432135|ref|XP_002120882.1| PREDICTED: similar to XCAP-C [Ciona intestinalis] Back     alignment and taxonomy information
 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 73/108 (67%)

Query: 84   YAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLE 143
            Y +R  E+  V    + Y   Y+    +R  EF   FV I  +++E YQM+T GG A+LE
Sbjct: 1225 YLQRVGELDQVTGKRDKYRGMYDNLRKRRLNEFCDGFVVITNKLKEIYQMITLGGDAELE 1284

Query: 144  YKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYY 191
            + +  DP+++GI + VRPP+KSWK+I  LSGGEKTL+SLALVFALHYY
Sbjct: 1285 FVDSLDPFSEGINFSVRPPKKSWKTIRHLSGGEKTLSSLALVFALHYY 1332

Source: Ciona intestinalis

Species: Ciona intestinalis

Genus: Ciona

Family: Cionidae

Order: Enterogona

Class: Ascidiacea

Phylum: Chordata

Superkingdom: Eukaryota
>gi|15291771|gb|AAK93154.1| LD25919p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194884406|ref|XP_001976251.1| GG20110 [Drosophila erecta] gi|190659438|gb|EDV56651.1| GG20110 [Drosophila erecta] Back     alignment and taxonomy information
>gi|391326224|ref|XP_003737619.1| PREDICTED: structural maintenance of chromosomes protein 4-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|348534713|ref|XP_003454846.1| PREDICTED: structural maintenance of chromosomes protein 4-like isoform 2 [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|348534711|ref|XP_003454845.1| PREDICTED: structural maintenance of chromosomes protein 4-like isoform 1 [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|6469332|gb|AAF13306.1|AF185287_1 XCAP-C/SMC4 homolog Gluon [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24584683|ref|NP_723996.1| gluon [Drosophila melanogaster] gi|6014602|gb|AAF01416.1|AF186472_1 condensin subunit SMC4 [Drosophila melanogaster] gi|7298332|gb|AAF53560.1| gluon [Drosophila melanogaster] gi|159884137|gb|ABX00747.1| LD13578p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195344564|ref|XP_002038851.1| GM17160 [Drosophila sechellia] gi|194133981|gb|EDW55497.1| GM17160 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195484008|ref|XP_002090524.1| GE13167 [Drosophila yakuba] gi|194176625|gb|EDW90236.1| GE13167 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
FB|FBgn0015391 1409 glu "gluon" [Drosophila melano 0.542 0.076 0.481 4.4e-22
MGI|MGI:19173491286 Smc4 "structural maintenance o 0.542 0.083 0.481 3.5e-21
UNIPROTKB|Q9ERA51243 SMC4 "Structural maintenance o 0.542 0.086 0.481 4.3e-21
UNIPROTKB|F1MAD91286 Smc4 "Structural maintenance o 0.542 0.083 0.481 4.5e-21
UNIPROTKB|F1SH511288 SMC4 "Structural maintenance o 0.542 0.083 0.490 4.5e-21
UNIPROTKB|F1NN18609 SMC4 "Uncharacterized protein" 0.542 0.177 0.481 5.5e-21
UNIPROTKB|E9PD531263 SMC4 "Structural maintenance o 0.542 0.085 0.481 7.2e-21
UNIPROTKB|Q9NTJ31288 SMC4 "Structural maintenance o 0.542 0.083 0.481 7.4e-21
UNIPROTKB|E2RCX41288 SMC4 "Structural maintenance o 0.542 0.083 0.481 9.5e-21
UNIPROTKB|P505321290 smc4 "Structural maintenance o 0.542 0.083 0.481 1.2e-20
FB|FBgn0015391 glu "gluon" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 271 (100.5 bits), Expect = 4.4e-22, P = 4.4e-22
 Identities = 52/108 (48%), Positives = 72/108 (66%)

Query:    84 YAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLE 143
             Y  R + ++ + +  N     YE+   +R KEF   F  I ++++E YQM+T GG A+LE
Sbjct:  1118 YLDRVRVLEDITSKRNEMRDKYEEVRKRRYKEFMDGFSIITRKLKEMYQMITLGGDAELE 1177

Query:   144 YKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYY 191
               +  DP+ +G+ + VRPP+KSWK I  LSGGEKTL+SLALVFALHYY
Sbjct:  1178 LVDSMDPFTEGVNFTVRPPKKSWKYISNLSGGEKTLSSLALVFALHYY 1225
GO:0007076 "mitotic chromosome condensation" evidence=ISS;NAS;IMP
GO:0000796 "condensin complex" evidence=ISS;NAS;TAS
GO:0000166 "nucleotide binding" evidence=ISS
GO:0003677 "DNA binding" evidence=ISS
GO:0007422 "peripheral nervous system development" evidence=TAS
GO:0005634 "nucleus" evidence=ISS;IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0000785 "chromatin" evidence=IDA
GO:0007067 "mitosis" evidence=IMP
GO:0005694 "chromosome" evidence=IDA
GO:0000070 "mitotic sister chromatid segregation" evidence=ISS;NAS;IMP
GO:0006281 "DNA repair" evidence=IEA
GO:0006310 "DNA recombination" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0007062 "sister chromatid cohesion" evidence=IEA
GO:0000819 "sister chromatid segregation" evidence=IMP
GO:0007052 "mitotic spindle organization" evidence=IMP
MGI|MGI:1917349 Smc4 "structural maintenance of chromosomes 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ERA5 SMC4 "Structural maintenance of chromosomes protein 4" [Microtus arvalis (taxid:47230)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAD9 Smc4 "Structural maintenance of chromosomes protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SH51 SMC4 "Structural maintenance of chromosomes protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NN18 SMC4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E9PD53 SMC4 "Structural maintenance of chromosomes protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NTJ3 SMC4 "Structural maintenance of chromosomes protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RCX4 SMC4 "Structural maintenance of chromosomes protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P50532 smc4 "Structural maintenance of chromosomes protein 4" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q20060SMC4_CAEELNo assigned EC number0.550.40200.0516yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-22
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 4e-22
cd03274212 cd03274, ABC_SMC4_euk, ATP-binding cassette domain 1e-14
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-12
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-12
cd03275247 cd03275, ABC_SMC1_euk, ATP-binding cassette domain 1e-07
cd03278197 cd03278, ABC_SMC_barmotin, ATP-binding cassette do 9e-05
cd03239178 cd03239, ABC_SMC_head, The SMC head domain belongs 0.002
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 0.004
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information 
 Score = 94.4 bits (235), Expect = 1e-22
 Identities = 36/110 (32%), Positives = 56/110 (50%)

Query: 82   RDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKAD 141
              Y +   + + +           E+   ++++ F   F KI +   E ++ L  GG A+
Sbjct: 977  ERYEELKSQREDLEEAKEKLLEVIEELDKEKRERFKETFDKINENFSEIFKELFGGGTAE 1036

Query: 142  LEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYY 191
            LE  E  DP   GI+   RPP K  +S+  LSGGEK+L +LAL+FA+  Y
Sbjct: 1037 LELTEPDDPLTAGIEISARPPGKKLQSLSLLSGGEKSLTALALLFAIQKY 1086

Length = 1163
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|213241 cd03274, ABC_SMC4_euk, ATP-binding cassette domain of eukaryotic SMC4 proteins Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|213242 cd03275, ABC_SMC1_euk, ATP-binding cassette domain of eukaryotic SMC1 proteins Back     alignment and domain information
>gnl|CDD|213245 cd03278, ABC_SMC_barmotin, ATP-binding cassette domain of barmotin, a member of the SMC protein family Back     alignment and domain information
>gnl|CDD|213206 cd03239, ABC_SMC_head, The SMC head domain belongs to the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 199
COG11961163 Smc Chromosome segregation ATPases [Cell division 99.95
KOG0996|consensus1293 99.88
KOG0018|consensus1141 99.88
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 99.85
KOG0964|consensus1200 99.78
KOG0933|consensus1174 99.73
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 99.71
KOG0979|consensus1072 99.65
KOG0250|consensus1074 98.54
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 98.08
PRK03918880 chromosome segregation protein; Provisional 98.07
PRK02224880 chromosome segregation protein; Provisional 98.03
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 97.8
PRK10869553 recombination and repair protein; Provisional 97.77
TIGR00634563 recN DNA repair protein RecN. All proteins in this 97.58
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 97.06
PHA02562562 46 endonuclease subunit; Provisional 97.04
PF13166 712 AAA_13: AAA domain 96.24
PRK01156895 chromosome segregation protein; Provisional 96.13
PF135141111 AAA_27: AAA domain 96.04
PF1355890 SbcCD_C: Putative exonuclease SbcCD, C subunit; PD 95.02
COG0497557 RecN ATPase involved in DNA repair [DNA replicatio 94.99
PRK04778569 septation ring formation regulator EzrA; Provision 94.66
PRK00064361 recF recombination protein F; Reviewed 93.84
COG4694 758 Uncharacterized protein conserved in bacteria [Fun 93.48
TIGR006181042 sbcc exonuclease SbcC. This family is based on the 92.03
TIGR00611365 recf recF protein. All proteins in this family for 91.99
PRK14079349 recF recombination protein F; Provisional 91.86
PRK102461047 exonuclease subunit SbcC; Provisional 91.71
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 91.37
COG1136226 SalX ABC-type antimicrobial peptide transport syst 89.76
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 89.65
TIGR006061311 rad50 rad50. This family is based on the phylogeno 89.57
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 89.17
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 87.25
cd03239178 ABC_SMC_head The structural maintenance of chromos 85.7
COG4717984 Uncharacterized conserved protein [Function unknow 85.67
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 84.88
COG2884223 FtsE Predicted ATPase involved in cell division [C 84.69
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 84.35
COG1126240 GlnQ ABC-type polar amino acid transport system, A 83.88
PF00005137 ABC_tran: ABC transporter This structure is on hol 83.78
COG1135 339 AbcC ABC-type metal ion transport system, ATPase c 83.19
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 83.15
COG0488530 Uup ATPase components of ABC transporters with dup 82.94
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 82.13
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 82.09
COG1101263 PhnK ABC-type uncharacterized transport system, AT 81.46
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 81.28
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 81.05
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 80.93
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 80.39
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 80.36
PRK048631486 mukB cell division protein MukB; Provisional 80.23
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 80.08
COG4619223 ABC-type uncharacterized transport system, ATPase 80.02
KOG0062|consensus582 80.01
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information 
Probab=99.95  E-value=3.7e-28  Score=246.20  Aligned_cols=136  Identities=28%  Similarity=0.449  Sum_probs=124.7

Q ss_pred             CCCCCCccchh-hhhcCCCCchhHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         59 KWRSPVSGSDV-TAAVRPTPELPVRDYAKRSKEMQAVLAT-------LNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQEC  130 (199)
Q Consensus        59 ~lr~~~~~i~~-l~~~~~vN~~ai~ey~e~~er~e~L~~e-------~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs~i  130 (199)
                      .|+..+..+.. +..+|+||+.|+++|++..++|++|..+       +++|.+.|++++++++.+|+.+|+.||.+|+.+
T Consensus       946 ~~~~~i~~le~~i~~lg~VN~~Aiee~e~~~~r~~~l~~~~~dl~~a~~~l~~~i~~~d~~~~~~f~~~f~~In~~F~~i 1025 (1163)
T COG1196         946 ELEREIERLEEEIEALGPVNLRAIEEYEEVEERYEELKSQREDLEEAKEKLLEVIEELDKEKRERFKETFDKINENFSEI 1025 (1163)
T ss_pred             HHHHHHHHHHHHHHhccCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            56666666655 5779999999999999999888876655       457888999999999999999999999999999


Q ss_pred             HhhhcCCceEEEEeccCCCCCCcceEEEEECCCCcccccccCCcchHHHHHHHHHHHHHHhcHh
Q psy12760        131 YQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYWLW  194 (199)
Q Consensus       131 F~~L~~gG~a~L~l~~~edp~~~GI~I~V~p~gk~~~~l~~LSGGEKSlaaLalIfAL~~~~~~  194 (199)
                      |+.|++||+|+|.+.+++|||++||+|.|+||||.+++++.|||||||++|||||||||+|+|-
T Consensus      1026 f~~L~~GG~a~L~l~~~dd~l~~Giei~a~ppgK~~~~l~~LSGGEKsLtAlAllFAi~~~~Pa 1089 (1163)
T COG1196        1026 FKELFGGGTAELELTEPDDPLTAGIEISARPPGKKLQSLSLLSGGEKSLTALALLFAIQKYRPA 1089 (1163)
T ss_pred             HHHhCCCCeeEEEeCCCCchhhcCcEEEEECCCCCccchhhcCCcHHHHHHHHHHHHHHhhCCC
Confidence            9999999999999999999999999999999999999999999999999999999999999993

>KOG0996|consensus Back     alignment and domain information
>KOG0018|consensus Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>KOG0964|consensus Back     alignment and domain information
>KOG0933|consensus Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>KOG0979|consensus Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A Back     alignment and domain information
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>COG4694 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>TIGR00611 recf recF protein Back     alignment and domain information
>PRK14079 recF recombination protein F; Provisional Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>COG4717 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>KOG0062|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
1w1w_A430 Sc Smc1hd:scc1-c Complex, Atpgs Length = 430 5e-11
3zgx_A426 Crystal Structure Of The Kleisin-n Smc Interface In 9e-10
1xex_B172 Structural Biochemistry Of Atp-Driven Dimerization 2e-08
1xew_Y172 Structural Biochemistry Of Atp-Driven Dimerization 2e-08
3kta_B173 Structural Basis For Adenylate Kinase Activity In A 3e-08
4i99_A354 Crystal Structure Of The Smchead Bound To The C-win 4e-08
1e69_A322 Smc Head Domain From Thermotoga Maritima Length = 3 1e-04
>pdb|1W1W|A Chain A, Sc Smc1hd:scc1-c Complex, Atpgs Length = 430 Back     alignment and structure 
Iteration: 1

 Score = 63.9 bits (154), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 52/90 (57%), Gaps = 9/90 (10%)
Query: 111 KRQKEFDTNFVKIGKRVQECYQMLT---------FGGKADLEYKEYSDPYAQGIKYVVRP 161
           KR++ F+  F  +   +   Y+ LT          GG A L  ++  +P+  GIKY   P
Sbjct: 264 KRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATP 323
Query: 162 PRKSWKSIDCLSGGEKTLASLALVFALHYY 191
           P K +K ++ LSGGEKT+A+LAL+FA++ Y
Sbjct: 324 PLKRFKDMEYLSGGEKTVAALALLFAINSY 353
>pdb|3ZGX|A Chain A, Crystal Structure Of The Kleisin-n Smc Interface In Prokaryotic Condensin Length = 426 Back     alignment and structure
>pdb|1XEX|B Chain B, Structural Biochemistry Of Atp-Driven Dimerization And Dna Stimulated Activation Of Smc Atpases Length = 172 Back     alignment and structure
>pdb|1XEW|Y Chain Y, Structural Biochemistry Of Atp-Driven Dimerization And Dna Stimulated Activation Of Smc Atpases Length = 172 Back     alignment and structure
>pdb|3KTA|B Chain B, Structural Basis For Adenylate Kinase Activity In Abc Atpases Length = 173 Back     alignment and structure
>pdb|4I99|A Chain A, Crystal Structure Of The Smchead Bound To The C-winged Helix Domain Of Scpa Length = 354 Back     alignment and structure
>pdb|1E69|A Chain A, Smc Head Domain From Thermotoga Maritima Length = 322 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 1e-28
3kta_B173 Chromosome segregation protein SMC; structural mai 3e-16
1e69_A322 Chromosome segregation SMC protein; structural mai 3e-12
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 Back     alignment and structure
 Score =  109 bits (274), Expect = 1e-28
 Identities = 36/117 (30%), Positives = 60/117 (51%), Gaps = 9/117 (7%)

Query: 84  YAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTF------- 136
           +   + E + + A        + +   KR++ F+  F  +   +   Y+ LT        
Sbjct: 237 FEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVE 296

Query: 137 --GGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYY 191
             GG A L  ++  +P+  GIKY   PP K +K ++ LSGGEKT+A+LAL+FA++ Y
Sbjct: 297 LAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSY 353
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Length = 173 Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Length = 322 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
3kta_B173 Chromosome segregation protein SMC; structural mai 99.76
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 99.42
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 97.9
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 97.24
1e69_A322 Chromosome segregation SMC protein; structural mai 97.09
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 96.76
4aby_A415 DNA repair protein RECN; hydrolase, double strand 96.5
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 96.43
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 93.79
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 89.15
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 87.45
1g6h_A257 High-affinity branched-chain amino acid transport 87.23
1b0u_A262 Histidine permease; ABC transporter, transport pro 86.39
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 86.31
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 86.29
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 86.29
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 86.17
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 85.84
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 85.79
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 85.63
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 85.42
1ji0_A240 ABC transporter; ATP binding protein, structural g 85.26
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 85.24
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 85.16
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 84.9
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 84.48
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 84.25
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 84.2
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 84.11
1sgw_A214 Putative ABC transporter; structural genomics, P p 84.05
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 83.57
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 83.32
2ghi_A260 Transport protein; multidrug resistance protein, M 83.31
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 83.1
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 82.98
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 82.33
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 82.09
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 81.89
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 81.85
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 81.52
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 81.41
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 80.89
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 80.27
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
Probab=99.76  E-value=1.6e-18  Score=141.18  Aligned_cols=86  Identities=31%  Similarity=0.548  Sum_probs=80.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhhcCCceEEEEeccCCCCCCcceEEEEECCCCcccccccCCcchHHHHHHHHHHH
Q psy12760        108 CLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       108 L~~kr~~~F~~~f~~In~~fs~iF~~L~~gG~a~L~l~~~edp~~~GI~I~V~p~gk~~~~l~~LSGGEKSlaaLalIfA  187 (199)
                      ++++++++|+++|++|+.+|+++|+.|++||++.+.+.+++||+..|+++.+.|+|+..+.+..||||||+++++|++||
T Consensus         1 ~~~~~~~~f~~~f~~i~~~f~~~f~~L~~~g~~~l~l~~~~~~~~~gl~i~~~~~~~~~~~~~~LSgGekqr~ala~~la   80 (173)
T 3kta_B            1 MEKEKKNVFMRTFEAISRNFSEIFAKLSPGGSARLILENPEDPFSGGLEIEAKPAGKDVKRIEAMSGGEKALTALAFVFA   80 (173)
T ss_dssp             --CHHHHHHHHHHHHHHHHHHHHHHHHSTTCEEEEEESCSSSGGGSCEEEEEETTSSSCCCGGGCCHHHHHHHHHHHHHH
T ss_pred             CcHHHHHHHHHHHHHHHHHHHHHHHHhCCCCEEEEEeeCCCCccccCceEEecCCCccccccccCCHHHHHHHHHHHHHH
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcH
Q psy12760        188 LHYYWL  193 (199)
Q Consensus       188 L~~~~~  193 (199)
                      ++.++|
T Consensus        81 ~~~~~~   86 (173)
T 3kta_B           81 IQKFKP   86 (173)
T ss_dssp             HHHHSC
T ss_pred             hcccCC
Confidence            997664
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 199
g1xew.1329 c.37.1.12 (X:,Y:) Smc head domain {Pyrococcus furi 1e-08
d1w1wa_427 c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac 4e-07
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 99.42
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.31
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.94
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 97.92
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.52
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 87.71
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 84.33
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 84.12
d1g2912240 Maltose transport protein MalK, N-terminal domain 83.81
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 82.94
d2awna2232 Maltose transport protein MalK, N-terminal domain 82.85
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 82.2
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 82.02
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 81.36
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 81.04
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 80.61
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Smc head domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.42  E-value=6.4e-14  Score=119.79  Aligned_cols=105  Identities=34%  Similarity=0.591  Sum_probs=57.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhc---------CCceEEEEeccCCCCCCcceEEEE
Q psy12760         89 KEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLT---------FGGKADLEYKEYSDPYAQGIKYVV  159 (199)
Q Consensus        89 er~e~L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs~iF~~L~---------~gG~a~L~l~~~edp~~~GI~I~V  159 (199)
                      .+++.+.....++...+.++++.....+...++.++.+++.+|..+.         .+|.++|.+.+.++++..|++|.|
T Consensus       241 ~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~l~~i~~~l~~~~~~~~~~~~~~~~l~~~~~~~~~~~~i~i~~  320 (427)
T d1w1wa_         241 NETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHA  320 (427)
T ss_dssp             ------------------------------CHHHHHHHHHHHHHHTC-----------CEEEEC------------CEEE
T ss_pred             ccchhhhhhhhhhhhcchhhhhHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhccccCceeEEeeeccCcccccCceEEE
Confidence            34445555566778888899999999999999999999999999986         357889999888899999999999


Q ss_pred             ECCCCcccccccCCcchHHHHHHHHHHHHHHhcH
Q psy12760        160 RPPRKSWKSIDCLSGGEKTLASLALVFALHYYWL  193 (199)
Q Consensus       160 ~p~gk~~~~l~~LSGGEKSlaaLalIfAL~~~~~  193 (199)
                      .|+|+...++..||||||++++|||+||++.+.|
T Consensus       321 ~~~~~~~~~~~~lSgGEk~~~~lal~lal~~~~~  354 (427)
T d1w1wa_         321 TPPLKRFKDMEYLSGGEKTVAALALLFAINSYQP  354 (427)
T ss_dssp             ECTTCCCCCGGGSCHHHHHHHHHHHHHHHHTSSC
T ss_pred             EeccchhhhhhhhccchHHHHHHHHHHHHhcCCC
Confidence            9999999999999999999999999999999876
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure