Diaphorina citri psyllid: psy12782


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MTNTASARQVQVTLGDYVINSAVEPLPAYTFGVRKINVHPYFKFTPQADRYDVAVLRLDRPVQYMPHIAPICLPEKGEDFLGQFGWAAGWGALQAGSRLRPKTLQAVDVPIIDNRQCERWHKSNGINVVIYDEMMCAGYRGGAKDSCQGDSGGPLMMERTGRWFLIGIVSAGYSCAQQGQPGIYHRVAYTVDWISYIMNTATN
cccccccccEEEEEccEEccccccccccEEEEEEEEEEccccccccccccccEEEEEEccccccccccccccccccccccccccEEEEEcccccccccccccccEEEEEEEccHHHHHHHHccccccccccccEEEEccccccccccccccccEEEEEEccEEEEEEEEEEcccccccccccEEEEccccHHHHHHHHccccc
*****SARQVQVTLGDYVINSAVEPLPAYTFGVRKINVHPYFKFTPQADRYDVAVLRLDRPVQYMPHIAPICLPEKGEDFLGQFGWAAGWGALQAGSRLRPKTLQAVDVPIIDNRQCERWHKSNGINVVIYDEMMCAGYRGGAKDSCQGDSGGPLMMERTGRWFLIGIVSAGYSCAQQGQPGIYHRVAYTVDWISYIMN****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTNTASARQVQVTLGDYVINSAVEPLPAYTFGVRKINVHPYFKFTPQADRYDVAVLRLDRPVQYMPHIAPICLPEKGEDFLGQFGWAAGWGALQAGSRLRPKTLQAVDVPIIDNRQCERWHKSNGINVVIYDEMMCAGYRGGAKDSCQGDSGGPLMMERTGRWFLIGIVSAGYSCAQQGQPGIYHRVAYTVDWISYIMNTATN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031224 [CC]intrinsic to membraneprobableGO:0005575, GO:0044425, GO:0016020
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0004175 [MF]endopeptidase activityprobableGO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824
GO:0008236 [MF]serine-type peptidase activityprobableGO:0016787, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0030195 [BP]negative regulation of blood coagulationprobableGO:0032101, GO:0080134, GO:0051241, GO:0048583, GO:1900046, GO:0050789, GO:0008150, GO:0061041, GO:1900047, GO:0065007, GO:0051239, GO:0030193, GO:0048519, GO:0050818, GO:0050819
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GYL, chain B
Confidence level:very confident
Coverage over the Query: 5-201
View the alignment between query and template
View the model in PyMOL