Diaphorina citri psyllid: psy12788

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----

GRVVQHPVPPYALSWPAGYILAAGSDRIVTIYESDGRVHRIFDYTAPHYKEREFTVACSSPSGQAVVVGSYDNIKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIMGNDRYLVARTPDTLLLGDLHRNLLSEVLWPDSGRNEKFYFDNVTVCLVFNAGELSIIEYGNNEILTCVRIPTDSSEV

ccEEccccccEEEEccccEEEEEEccccEEEECccccEEEEEEccccccccccEEEEEEcccccEEEEECcccEEEEECccccccEEccccccccccccEEEEEEcccccEEEEEEccccEEEEEEEEEEEEEEccEEEEEEcccEEEEEEccccccccEEEEEEccccEEEEEEEEccCEEEEEEcccEEEEEEcccccEEEECcccccccEEEEECccEEEEEEEccEEEEEEEccccCEEEEccccccccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Intraflagellar transport protein osm-1	Required for the maintenance and formation of cilia.	confident	Q9W040
Intraflagellar transport protein 172 homolog	Required for the maintenance and formation of cilia.	confident	Q5RHH4
Intraflagellar transport protein 172 homolog	Required for the maintenance and formation of cilia. Plays an indirect role in hedgehog (Hh) signaling, cilia being required for all activity of the hedgehog pathway.	confident	Q9JKU3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044463 [CC]	cell projection part	probable	GO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0031513 [CC]	nonmotile primary cilium	probable	GO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0048646 [BP]	anatomical structure formation involved in morphogenesis	probable	GO:0032502, GO:0009653, GO:0008150, GO:0048856
GO:0060271 [BP]	cilium morphogenesis	probable	GO:0032502, GO:0000902, GO:0048856, GO:0032990, GO:0030030, GO:0048869, GO:0009987, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009653, GO:0044699, GO:0048858
GO:0050794 [BP]	regulation of cellular process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0044446 [CC]	intracellular organelle part	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008134 [MF]	transcription factor binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0048731 [BP]	system development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0031514 [CC]	motile cilium	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NR0, chain A
Confidence level:very confident
Coverage over the Query: 2-202
View the alignment between query and template
View the model in PyMOL

Template: 2OAJ, chain A
Confidence level:confident
Coverage over the Query: 3-249
View the alignment between query and template
View the model in PyMOL