Diaphorina citri psyllid: psy12790


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MKAGHPGGAYGKSGVEKLDESNKGHQMLKRMGWGGAGLGAKEQGIEAPISGGEVREREDLYKGVGVSLNDPYENFRKSKKQAFISRMKERQEHTRGAE
ccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccc
*************************QMLKRMGWG**GL*****GIE**I***********YKGVGV*******NFRKSKKQAF***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAGHPGGAYGKSGVEKLDESNKGHQMLKRMGWGGAGLGAKEQGIEAPISGGEVREREDLYKGVGVSLNDPYENFRKSKKQAFISRMKERQEHTRGAE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calcium homeostasis endoplasmic reticulum protein Involved in calcium homeostasis, growth and proliferation.confidentQ8IWX8
Calcium homeostasis endoplasmic reticulum protein Involved in calcium homeostasis, growth and proliferation.confidentQ8CGZ0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044325 [MF]ion channel bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0033017 [CC]sarcoplasmic reticulum membraneprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0016528, GO:0044432, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0016529, GO:0044424, GO:0044425, GO:0044422
GO:0051209 [BP]release of sequestered calcium ion into cytosolprobableGO:0050801, GO:0055065, GO:0051282, GO:0051283, GO:0032844, GO:0042592, GO:0055074, GO:0050789, GO:0044699, GO:0072507, GO:0051234, GO:0072503, GO:0065007, GO:0006812, GO:0048519, GO:0051641, GO:0019725, GO:0009987, GO:0060401, GO:0060402, GO:0006875, GO:0006874, GO:0006811, GO:0006810, GO:0006816, GO:0006873, GO:0050794, GO:0044765, GO:0030001, GO:0030003, GO:0051649, GO:0055080, GO:0072511, GO:0055082, GO:0032879, GO:0051179, GO:0016482, GO:0065008, GO:0070838, GO:0046907, GO:0051480, GO:0044763, GO:0007204, GO:0048878, GO:2000021, GO:0008150
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051533 [BP]positive regulation of NFAT protein import into nucleusprobableGO:0033157, GO:0032388, GO:0060341, GO:0051049, GO:0032386, GO:0051222, GO:0051223, GO:0050789, GO:0032880, GO:0065007, GO:0048518, GO:0070201, GO:0051050, GO:0090316, GO:0050794, GO:0008150, GO:0042307, GO:0042306, GO:0032879, GO:0042993, GO:0042990, GO:1900180, GO:0051532, GO:0046824, GO:0046822
GO:0008285 [BP]negative regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted