Diaphorina citri psyllid: psy12809

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
DSDVEYVGPGPLEFIEPLFSQKPCSYRLESYWTYEVCHGRYVRQFHEDRESKKEVKLQEYYLGRWDKTLNKLQDSPEGVMGFKKIEGIKLPYLEINMTDGTLCDLNGEPRETRVLYMCHSTGRHDIYSLKETSTCKYEVIILTSLLCKHPKFK
ccccccccccHHHHHHccccccccEEEEccEEEEEEccccEEEEEEEccccccccccEEEEEEEccccccccccccccccccCEECcccccEEEEEccccccccccccccEEEEEEEEcccccccEEEEECccccEEEEEEEccccccccccc
******VGPGPLEFIEPLFSQKPCSYRLESYWTYEVCHGRYVRQFHEDR***KEVKLQEYYLGRWDKTLNKL*D***G*M*FKKIEGIKLPYLEINMTDGTLCDLNGEPRETRVLYMCHSTGRHDIYSLKETSTCKYEVIILTSLLCKHPKFK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DSDVEYVGPGPLEFIEPLFSQKPCSYRLESYWTYEVCHGRYVRQFHEDRESKKEVKLQEYYLGRWDKTLNKLQDSPEGVMGFKKIEGIKLPYLEINMTDGTLCDLNGEPRETRVLYMCHSTGRHDIYSLKETSTCKYEVIILTSLLCKHPKFK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AIH, chain A
Confidence level:very confident
Coverage over the Query: 23-75,90-148
View the alignment between query and template
View the model in PyMOL