Diaphorina citri psyllid: psy12811


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70----
MNLFGAQSIVSFEILPQPNPKRSQDNPWPQFPRILKVDYGHEEVKVKHNHDPREFCIFELRFPFEECSPYETWC
cccccccEEEEcccccccccccccccccccccccccccccHHHHHHHHcccccEEEEEEEEEECccccccCCcc
*NLFGAQSIVSFEILPQPNPKRSQDNPWPQFPRILKVDYGHEEVKVKHNHDPREFCIFELRFPFEECSPYE***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLFGAQSIVSFEILPQPNPKRSQDNPWPQFPRILKVDYGHEEVKVKHNHDPREFCIFELRFPFEECSPYETWC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutamate synthase [NADH] Forms L-glutamate from L-glutamine and 2-oxoglutarate. Represents an alternative pathway to L-glutamate dehydrogenase for the biosynthesis of L-glutamate. Participates with glutamine synthetase in ammonia assimilation processes. The enzyme is specific for NADH, L-glutamine and 2-oxoglutarate.confidentQ12680

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VDC, chain G
Confidence level:confident
Coverage over the Query: 2-46
View the alignment between query and template
View the model in PyMOL