Forms L-glutamate from L-glutamine and 2-oxoglutarate. Represents an alternative pathway to L-glutamate dehydrogenase for the biosynthesis of L-glutamate. Participates with glutamine synthetase in ammonia assimilation processes. The enzyme is specific for NADH, L-glutamine and 2-oxoglutarate. Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292) EC: 1EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 4
Involved in glutamate biosynthesis and plays a major role in the primary ammonium ions assimilation in seedling roots. May be involved in the reutilization of glutamine in developing organs. Plays a role in the development of tillers.
Involved in glutamate biosynthesis. Required for non-photorespiratory ammonium assimilation. Probably involved in primary ammonium assimilation in roots.
Score = 43.9 bits (102), Expect = 3e-04, Method: Composition-based stats.
Identities = 16/39 (41%), Positives = 25/39 (64%)
Query: 5 GAQSIVSFEILPQPNPKRSQDNPWPQFPRILKVDYGHEE 43
GA ++ FEI+P+P R++ PWP +P + +V HEE
Sbjct: 310 GAIAVHQFEIMPRPPDARAESTPWPTYPLMYRVSAAHEE 348
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.323 0.142 0.487
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 30,749,972
Number of Sequences: 539616
Number of extensions: 1087874
Number of successful extensions: 1639
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1631
Number of HSP's gapped (non-prelim): 8
length of query: 74
length of database: 191,569,459
effective HSP length: 45
effective length of query: 29
effective length of database: 167,286,739
effective search space: 4851315431
effective search space used: 4851315431
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)
Mycobacterium tuberculosis (taxid: 1773)
EC: 1
EC: .
EC: 4
EC: .
EC: 1
EC: .
EC: 1
EC: 3
Close Homologs in the Non-Redundant Database Detected by BLAST
>gi|366989177|ref|XP_003674356.1| hypothetical protein NCAS_0A14190 [Naumovozyma castellii CBS 4309] gi|342300219|emb|CCC67977.1| hypothetical protein NCAS_0A14190 [Naumovozyma castellii CBS 4309]
Score = 177 (67.4 bits), Expect = 7.5e-12, P = 7.5e-12
Identities = 30/61 (49%), Positives = 40/61 (65%)
Query: 2 NLFGAQSIVSFEILPQPNPKRSQDNPWPQFPRILKVDYGHEEVKVKHNHDPREFCIFELR 61
N G +++ +FEILPQP P R +NPWP++P I +VDYGHEE K DPR + + R
Sbjct: 1973 NRLGCKTVGAFEILPQPGPNRKPENPWPEWPLIFRVDYGHEEAKEMTGSDPRTYSVSTKR 2032
Query: 62 F 62
F
Sbjct: 2033 F 2033
This model represents one of three built for the NADPH-dependent or NADH-dependent glutamate synthase (EC 1.4.1.13 and 1.4.1.14, respectively) small subunit or homologous region. TIGR01316 describes a family in several archaeal and deeply branched bacterial lineages of a homotetrameric form for which there is no large subunit. Another model describes glutamate synthase small subunit from gamma and some alpha subdivision Proteobacteria plus paralogs of unknown function. This model describes the small subunit, or homologous region of longer forms proteins, of eukaryotes, Gram-positive bacteria, cyanobacteria, and some other lineages. All members with known function participate in NADH or NADPH-dependent reactions to interconvert between glutamine plus 2-oxoglutarate and two molecules of glutamate. Length = 485
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only]
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only]
This model represents one of three built for the NADPH-dependent or NADH-dependent glutamate synthase (EC 1.4.1.13 and 1.4.1.14, respectively) small subunit or homologous region. TIGR01316 describes a family in several archaeal and deeply branched bacterial lineages of a homotetrameric form for which there is no large subunit. Another model describes glutamate synthase small subunit from gamma and some alpha subdivision Proteobacteria plus paralogs of unknown function. This model describes the small subunit, or homologous region of longer forms proteins, of eukaryotes, Gram-positive bacteria, cyanobacteria, and some other lineages. All members with known function participate in NADH or NADPH-dependent reactions to interconvert between glutamine plus 2-oxoglutarate and two molecules of glutamate.