Diaphorina citri psyllid: psy1281

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----

MDIFLNFAVDLDTEGRYLFLNAIANQLRYPNSHTHYFSCLLLYLFAEANTEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPVYKFWDHEFVHCAPEIEKLFESGWPLYAQLLIDIFKFLAPFLPQQQQQQQQSASFPLA

cHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHccccccccc

MDIFLNFAVDLDTEGRYLFLNAIANQLRYPNSHTHYFSCLLLYLFAEANTEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPVYKFWDHEFVHCAPEIEKLFESGWPLYAQLLIDIFKFLAPF*****************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDIFLNFAVDLDTEGRYLFLNAIANQLRYPNSHTHYFSCLLLYLFAEANTEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPVYKFWDHEFVHCAPEIEKLFESGWPLYAQLLIDIFKFLAPFLPQQQQQQQQSASFPLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
CCR4-NOT transcription complex subunit 1	Belongs to the CCR4-NOT complex that functions as general transcription regulation complex. Acts as a transcriptional repressor. Represses the ligand-dependent transcriptional activation by nuclear receptors.	very confident	Q6ZQ08
CCR4-NOT transcription complex subunit 1	Belongs to the CCR4-NOT complex that functions as general transcription regulation complex. Acts as a transcriptional repressor. Represses the ligand-dependent transcriptional activation by nuclear receptors.	very confident	A1A5H6
CCR4-NOT transcription complex subunit 1	Belongs to the CCR4-NOT complex that functions as general transcription regulation complex. Acts as a transcriptional repressor. Represses the ligand-dependent transcriptional activation by nuclear receptors.	very confident	A0JP85

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005778 [CC]	peroxisomal membrane	confident	GO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0005777, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0042579, GO:0044444, GO:0044424, GO:0044464, GO:0044439, GO:0044438, GO:0031903, GO:0043226, GO:0044422, GO:0043231
GO:0010606 [BP]	positive regulation of cytoplasmic mRNA processing body assembly	confident	GO:0051130, GO:0010603, GO:0033043, GO:0051128, GO:0044087, GO:0065007, GO:1902115, GO:1902117, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0042974 [MF]	retinoic acid receptor binding	confident	GO:0008134, GO:0035257, GO:0003674, GO:0005488, GO:0005515, GO:0051427, GO:0005102
GO:2000036 [BP]	regulation of stem cell maintenance	confident	GO:2000736, GO:0050793, GO:0060284, GO:0050794, GO:0045595, GO:0065007, GO:0051239, GO:0008150, GO:0050789
GO:0033147 [BP]	negative regulation of intracellular estrogen receptor signaling pathway	confident	GO:0033144, GO:0033146, GO:0009968, GO:0033143, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0030014 [CC]	CCR4-NOT complex	confident	GO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0030331 [MF]	estrogen receptor binding	confident	GO:0035258, GO:0035257, GO:0003674, GO:0005488, GO:0005515, GO:0051427, GO:0005102
GO:0004535 [MF]	poly(A)-specific ribonuclease activity	confident	GO:0016787, GO:0008408, GO:0016796, GO:0004518, GO:0004527, GO:0004540, GO:0004532, GO:0016788, GO:0000175, GO:0003824, GO:0016896, GO:0003674
GO:0000122 [BP]	negative regulation of transcription from RNA polymerase II promoter	confident	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0048387 [BP]	negative regulation of retinoic acid receptor signaling pathway	confident	GO:0009968, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0048385, GO:0050789, GO:0048523
GO:1900153 [BP]	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	confident	GO:0009896, GO:0009894, GO:0009893, GO:0031329, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0019219, GO:0065007, GO:1900151, GO:0048518, GO:0045935, GO:0060255, GO:0031331, GO:0061013, GO:0061014, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0019222, GO:0051252, GO:0051254, GO:0048522
GO:0060213 [BP]	positive regulation of nuclear-transcribed mRNA poly(A) tail shortening	confident	GO:0009896, GO:0009894, GO:0009893, GO:0031329, GO:0050685, GO:0050684, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0060255, GO:0065007, GO:1900151, GO:0048518, GO:0010468, GO:0045935, GO:0019219, GO:0031331, GO:0061013, GO:0061014, GO:0050794, GO:0060211, GO:0008150, GO:0051171, GO:0051173, GO:0019222, GO:0031442, GO:0031440, GO:0051252, GO:0051254, GO:0048522
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006351 [BP]	transcription, DNA-dependent	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0000289 [BP]	nuclear-transcribed mRNA poly(A) tail shortening	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0000288, GO:0044260, GO:0071704, GO:0010467, GO:0006401, GO:0006402, GO:0044238, GO:0031124, GO:0009987, GO:0006725, GO:0031123, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0000956, GO:0019439, GO:0006396, GO:0006397
GO:0007517 [BP]	muscle organ development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0061061, GO:0048731, GO:0007275, GO:0044699
GO:0048813 [BP]	dendrite morphogenesis	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0000932 [CC]	cytoplasmic mRNA processing body	probable	GO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0007095 [BP]	mitotic G2 DNA damage checkpoint	probable	GO:0010948, GO:0044773, GO:1901991, GO:1901990, GO:0050789, GO:0044699, GO:0051716, GO:0031572, GO:0031570, GO:0010564, GO:0065007, GO:0007049, GO:0048519, GO:0009987, GO:0007346, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0008150, GO:0044774, GO:1901988, GO:0000077, GO:0000075, GO:0051726, GO:0050896, GO:0044763, GO:0033554, GO:0022402, GO:0048523, GO:0007093
GO:0018996 [BP]	molting cycle, collagen and cuticulin-based cuticle	probable	GO:0008150, GO:0032501, GO:0042303, GO:0044699, GO:0044707
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0000003 [BP]	reproduction	probable	GO:0008150
GO:0030953 [BP]	astral microtubule organization	probable	GO:0006996, GO:0007017, GO:0007010, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0016043, GO:0031122, GO:0008150, GO:0007051, GO:0000226, GO:0022402, GO:0044699, GO:0044763, GO:0007049
GO:0008340 [BP]	determination of adult lifespan	probable	GO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0017148 [BP]	negative regulation of translation	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:2000112, GO:0031324, GO:0031323, GO:0050789, GO:0051248, GO:0010605, GO:0019222, GO:0010608, GO:0051246, GO:2000113, GO:0065007, GO:0031326, GO:0048519, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0032269, GO:0032268, GO:0010556, GO:0006417, GO:0010558, GO:0048523
GO:0040007 [BP]	growth	probable	GO:0008150
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0002009 [BP]	morphogenesis of an epithelium	probable	GO:0032502, GO:0048856, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0048729, GO:0009653, GO:0044699
GO:0040011 [BP]	locomotion	probable	GO:0008150
GO:0040001 [BP]	establishment of mitotic spindle localization	probable	GO:0008104, GO:0051653, GO:0000226, GO:0051656, GO:0044699, GO:0071840, GO:0016043, GO:0007049, GO:0033036, GO:0006996, GO:0000278, GO:0009987, GO:0051293, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051640, GO:0051641, GO:0031503, GO:0007017, GO:0007010, GO:0022402, GO:0008150
GO:0006898 [BP]	receptor-mediated endocytosis	probable	GO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1MHQ, chain A
Confidence level:probable
Coverage over the Query: 13-108
View the alignment between query and template
View the model in PyMOL