Diaphorina citri psyllid: psy12847

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MERTKETCLVALNESSCIGTKMLIAYYDKSCIIQAIMFGANPEYLYVDLTKLYSHIEYIKMFESKQSRDIIDRLEAYIVNPKQNCLDIKFKIEGTDFQKLVWSELCKIPFGSLCSYADVARNIGRPKSARAVANACGQNNIPILIPCHRVIRSDGSYGGYSSGKYIKETLIKIEQKIVSEKIQVHSLF
cccccccEEEEEECccccccEEEEEEEccccEEEEEEccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHccHHHHHHHHHHHccccccCEEccccEEccccccccccccHHHHHHHHHHHHcHHHHHHHHcccc
******TCLVALNESSCIGTKMLIAYYDKSCIIQAIMFGANPEYLYVDLTKLYSHIEYIKMFESKQSRDIIDRLEAYIVNPKQNCLDIKFKIEGTDFQKLVWSELCKIPFGSLCSYADVARNIGRPKSARAVANACGQNNIPILIPCHRVIRSDGSYGGYSSGKYIKETLIKIEQKI******VHSLF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERTKETCLVALNESSCIGTKMLIAYYDKSCIIQAIMFGANPEYLYVDLTKLYSHIEYIKMFESKQSRDIIDRLEAYIVNPKQNCLDIKFKIEGTDFQKLVWSELCKIPFGSLCSYADVARNIGRPKSARAVANACGQNNIPILIPCHRVIRSDGSYGGYSSGKYIKETLIKIEQKIVSEKIQVHSLF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Methylated-DNA--protein-cysteine methyltransferase Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA. Repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated. Also repairs O-4-methylthymine.confidentQ6BVY4
Methylated-DNA--protein-cysteine methyltransferase Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA. Repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.confidentP52982
Methylated-DNA--protein-cysteine methyltransferase Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA. Repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.confidentQ46EW4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005575 [CC]cellular_componentprobable

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable
2.1.1.63Methylated-DNA--[protein]-cysteine S-methyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EH6, chain A
Confidence level:very confident
Coverage over the Query: 21-183
View the alignment between query and template
View the model in PyMOL