Diaphorina citri psyllid: psy1285


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MVTKPQVASLVTCFVWDRRTLNETTAKPVGVLAGHRDGITFIDPKGDSRHLISNSKDQTIKLWDVRKFNGAANSKDQTIKLWDVRKFSNKTAQRNTFRAVCEQNWEYRRENVPRQLGT
cEEEEEccccccEEEEEccccccccccCEEEcccccccEEEEECcccccEEEEccccccEEEEEccccccccccccccCEEEEEEEcccccccccccccccccEEEEccccccccccc
MVTKPQVASLVTCFVWDRRTLNETTAKPVGVLAGHRDGITFIDPKGDSRHLISNSKDQTIKLWDVRKFNGAANSKDQTIKLWDVRKFSNKTAQRNTFRAVCEQNWEYRRENVP*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTKPQVASLVTCFVWDRRTLNETTAKPVGVLAGHRDGITFIDPKGDSRHLISNSKDQTIKLWDVRKFNGAANSKDQTIKLWDVRKFSNKTAQRNTFRAVCEQNWEYRRENVPRQLGT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DDB1- and CUL4-associated factor 11 May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.confidentQ5E9I8
DDB1- and CUL4-associated factor 11 May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.confidentQ8TEB1
DDB1- and CUL4-associated factor 11 May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.confidentQ5R7H5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005834 [CC]heterotrimeric G-protein complexprobableGO:0043234, GO:0019897, GO:0032991, GO:0016020, GO:0044464, GO:0009898, GO:0019898, GO:0005575, GO:0071944, GO:0005623, GO:0005886, GO:0044424, GO:0044425, GO:0005622, GO:0044459, GO:0031234
GO:0006796 [BP]phosphate-containing compound metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237, GO:0006793
GO:0010259 [BP]multicellular organismal agingprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0016567 [BP]protein ubiquitinationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0070887 [BP]cellular response to chemical stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0042221, GO:0044699
GO:0080008 [CC]Cul4-RING ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0006511 [BP]ubiquitin-dependent protein catabolic processprobableGO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0019941, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0043632, GO:0044238, GO:0009057
GO:0003824 [MF]catalytic activityprobableGO:0003674
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1P22, chain A
Confidence level:very confident
Coverage over the Query: 6-106
View the alignment between query and template
View the model in PyMOL