Diaphorina citri psyllid: psy12862

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MTMFEDIDGSDKESGGEHLKKFRCSSRDRIFFQTCNCNNHARKCRFNMELYKLSGRSSGGVCLQCRHFTAGRHCHYCKEGYYRDPSRPITHRKACKKV
ccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccc
*T**EDIDGSDKESGGEHLKKFRCSSRDRIFFQTCNCNNHARKCRFNMELYKLSGRSSGGVCLQCRHFTAGRHCHYCKEGYYRDPSRP****KAC***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTMFEDIDGSDKESGGEHLKKFRCSSRDRIFFQTCNCNNHARKCRFNMELYKLSGRSSGGVCLQCRHFTAGRHCHYCKEGYYRDPSRPITHRKACKKV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Netrin-1 Netrins control guidance of CNS commissural axons and peripheral motor axons. Its association with either DCC or some UNC5 receptors will lead to axon attraction or repulsion, respectively. It also serve as a survival factor via its association with its receptors which prevent the initiation of apoptosis. Involved in colorectal tumorigenesis by regulating apoptosis.confidentQ924Z9
Netrin-1 Netrins control guidance of CNS commissural axons and peripheral motor axons. Its association with either DCC or some UNC5 receptors will lead to axon attraction or repulsion, respectively. It also serve as a survival factor via its association with its receptors which prevent the initiation of apoptosis. Involved in colorectal tumorigenesis by regulating apoptosis.confidentQ2HXW4
Netrin-1 Netrins control guidance of CNS commissural axons and peripheral motor axons. Its association with either DCC or some UNC5 receptors will lead to axon attraction or repulsion, respectively. It also serve as a survival factor via its association with its receptors which prevent the initiation of apoptosis. Involved in tumorigenesis by regulating apoptosis.confidentO95631

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partconfidentGO:0005575, GO:0005623
GO:0005576 [CC]extracellular regionconfidentGO:0005575
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0007520 [BP]myoblast fusionprobableGO:0030154, GO:0061061, GO:0014706, GO:0000768, GO:0006949, GO:0009653, GO:0007275, GO:0044699, GO:0007517, GO:0051146, GO:0007519, GO:0048513, GO:0048869, GO:0035914, GO:0048646, GO:0032502, GO:0032501, GO:0014902, GO:0009987, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0033564 [BP]anterior/posterior axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0040023 [BP]establishment of nucleus localizationprobableGO:0051234, GO:0009987, GO:0008150, GO:0044763, GO:0044699, GO:0051649, GO:0051647, GO:0051656, GO:0051179, GO:0051640, GO:0051641
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0030517 [BP]negative regulation of axon extensionprobableGO:0022604, GO:0048638, GO:0044707, GO:0045926, GO:0051239, GO:0030308, GO:0022603, GO:0030154, GO:0051129, GO:0051128, GO:0060284, GO:0061387, GO:0031345, GO:0031344, GO:0044699, GO:0016043, GO:0050767, GO:0048869, GO:0040008, GO:0050768, GO:0050789, GO:0045664, GO:0010769, GO:0065007, GO:0071840, GO:0010721, GO:0048640, GO:0048519, GO:0065008, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0008361, GO:0001558, GO:0044763, GO:0090066, GO:0010975, GO:0048731, GO:0030516, GO:0022008, GO:0051093, GO:0048699, GO:0050771, GO:0050770, GO:0007399, GO:0048856, GO:0045595, GO:0051960, GO:2000026, GO:0032535, GO:0007275, GO:0008150, GO:0048523
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0045773 [BP]positive regulation of axon extensionprobableGO:0048639, GO:0048638, GO:0048856, GO:0045927, GO:0022603, GO:0030307, GO:0030154, GO:0051128, GO:0016043, GO:0061387, GO:0031344, GO:0044699, GO:0031346, GO:0050767, GO:0048869, GO:0040008, GO:0060284, GO:0050769, GO:0045664, GO:0010769, GO:0065007, GO:0071840, GO:0010720, GO:0048518, GO:0065008, GO:0051130, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0008361, GO:0001558, GO:0044763, GO:0090066, GO:0010975, GO:0048731, GO:0030516, GO:0022008, GO:0051239, GO:0044707, GO:0048699, GO:0050770, GO:0007399, GO:0050772, GO:0022604, GO:0051094, GO:0045595, GO:0050789, GO:0051960, GO:2000026, GO:0007275, GO:0008150, GO:0032502, GO:0032535, GO:0048522
GO:0016358 [BP]dendrite developmentprobableGO:0048666, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0032502, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0043208 [MF]glycosphingolipid bindingprobableGO:0005488, GO:0003674, GO:0046625, GO:0008289, GO:0051861
GO:0042063 [BP]gliogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:0060603 [BP]mammary gland duct morphogenesisprobableGO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0060443, GO:0048513, GO:0048729, GO:0022612, GO:0030879, GO:0032502, GO:0032501, GO:0035239, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0060562, GO:0035295, GO:0044707, GO:0048856, GO:0048731, GO:0048732, GO:0061180
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0016525 [BP]negative regulation of angiogenesisprobableGO:0051093, GO:0022603, GO:0050793, GO:0045765, GO:0008150, GO:1901342, GO:0065007, GO:2000026, GO:0051239, GO:0048519, GO:0050789
GO:0005610 [CC]laminin-5 complexprobableGO:0043234, GO:0005605, GO:0005604, GO:0032991, GO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0043256, GO:0044420, GO:0044421
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0034446 [BP]substrate adhesion-dependent cell spreadingprobableGO:0032502, GO:0031589, GO:0000904, GO:0000902, GO:0009653, GO:0048869, GO:0030154, GO:0048468, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0007155, GO:0008150, GO:0009987, GO:0022610, GO:0044699, GO:0048856
GO:0001764 [BP]neuron migrationprobableGO:0040011, GO:0032502, GO:0048699, GO:0048856, GO:0044707, GO:0007399, GO:0048870, GO:0009987, GO:0048869, GO:0032501, GO:0030154, GO:0006928, GO:0008150, GO:0051674, GO:0044763, GO:0007275, GO:0048731, GO:0022008, GO:0016477, GO:0051179, GO:0044699
GO:0001569 [BP]patterning of blood vesselsprobableGO:0048754, GO:0072359, GO:0001763, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0001525, GO:0001568, GO:0001944, GO:0048514, GO:0048729, GO:0060562, GO:0048646, GO:0032502, GO:0032501, GO:0035239, GO:0061138, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0035295, GO:0044707, GO:0048856, GO:0072358, GO:0048731, GO:0002009
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0016337 [BP]cell-cell adhesionprobableGO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0008045 [BP]motor neuron axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0030334 [BP]regulation of cell migrationprobableGO:0051270, GO:0050794, GO:0008150, GO:0040012, GO:2000145, GO:0065007, GO:0032879, GO:0050789
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0048665 [BP]neuron fate specificationprobableGO:0032502, GO:0048699, GO:0045165, GO:0048663, GO:0030182, GO:0009987, GO:0048869, GO:0001708, GO:0030154, GO:0007399, GO:0032501, GO:0044763, GO:0048731, GO:0044707, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0042472 [BP]inner ear morphogenesisprobableGO:0042471, GO:0048598, GO:0048839, GO:0048562, GO:0044707, GO:0007423, GO:0048568, GO:0032501, GO:0048856, GO:0009887, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0043583, GO:0048731, GO:0009653, GO:0032502, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AQS, chain A
Confidence level:very confident
Coverage over the Query: 18-94
View the alignment between query and template
View the model in PyMOL