Netrins control guidance of CNS commissural axons and peripheral motor axons. Its association with either DCC or some UNC5 receptors will lead to axon attraction or repulsion, respectively. It also serve as a survival factor via its association with its receptors which prevent the initiation of apoptosis. Involved in tumorigenesis by regulating apoptosis. Homo sapiens (taxid: 9606)
Netrins control guidance of CNS commissural axons and peripheral motor axons. Promotes neurite outgrowth from commissural axons but acts as a chemorepellent for trochlear motor axons. These effects are mediated by distinct receptors.
Netrins control guidance of CNS commissural axons and peripheral motor axons. Its association with either DCC or some UNC5 receptors will lead to axon attraction or repulsion, respectively. It also serve as a survival factor via its association with its receptors which prevent the initiation of apoptosis. Involved in colorectal tumorigenesis by regulating apoptosis.
Netrins control guidance of CNS commissural axons and peripheral motor axons. Its association with either DCC or some UNC5 receptors will lead to axon attraction or repulsion, respectively. It also serve as a survival factor via its association with its receptors which prevent the initiation of apoptosis. Involved in colorectal tumorigenesis by regulating apoptosis.
Netrins control guidance of CNS commissural axons and peripheral motor axons. Its association with either DCC or some UNC5 receptors will lead to axon attraction or repulsion, respectively. It also serve as a survival factor via its association with its receptors which prevent the initiation of apoptosis. Involved in colorectal tumorigenesis by regulating apoptosis.
Netrins control guidance of CNS commissural axons and peripheral motor axons. Its association with either fra or unc-5 receptors will lead to axon attraction or repulsion, respectively. While short-range repulsion requires both fra and unc-5 receptors, long-range repulsion only requires unc-5.
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation
They are composed of distinct but related alpha, beta and gamma chains. The three chains form a cross-shaped molecule that consist of a long arm and three short globular arms. The long arm consist of a coiled coil structure contributed by all three chains and cross-linked by interchain disulphide bonds. Beside different types of globular domains each subunit contains, in its first half, consecutive repeats of about 60 amino acids in length that include eight conserved cysteines []. The tertiary structure [, ] of this domain is remotely similar in its N-terminal to that of the EGF-like module (see PDOC00021 from PROSITEDOC). It is known as a 'LE' or 'laminin-type EGF-like' domain. The number of copies of the LE domain in the different forms of laminins is highly variable; from 3 up to 22 copies have been found. A schematic representation of the topology of the four disulphide bonds in the LE domain is shown below. +-------------------+ +-|-----------+ | +--------+ +-----------------+ | | | | | | | | xxCxCxxxxxxxxxxxCxxxxxxxCxxCxxxxxGxxCxxCxxgaagxxxxxxxxxxxCxx sssssssssssssssssssssssssssssssssss 'C': conserved cysteine involved in a disulphide bond 'a': conserved aromatic residue 'G': conserved glycine (lower case = less conserved) 's': region similar to the EGF-like domain In mouse laminin gamma-1 chain, the seventh LE domain has been shown to be the only one that binds with a high affinity to nidogen []. The binding-sites are located on the surface within the loops C1-C3 and C5-C6 [, ]. Long consecutive arrays of LE domains in laminins form rod-like elements of limited flexibility [], which determine the spacing in the formation of laminin networks of basement membranes [].; PDB: 3TBD_A 3ZYG_B 3ZYI_B 2Y38_A 1KLO_A 1NPE_B 3ZYJ_B 1TLE_A.
Score = 47.4 bits (112), Expect = 8e-08
Identities = 19/63 (30%), Positives = 26/63 (41%), Gaps = 1/63 (1%)
Query: 33 QTCNCNNHARKCRFNMELYKLSGRSSGGVCLQCRHFTAGRHCHYCKEGYYRDPSRPITHR 92
C C HA +C + + G C CRH T G +C C + Y+ P RP R
Sbjct: 252 GNCFCYGHASECAPVDGVNEEVEGMVHGHC-MCRHNTKGLNCELCMDFYHDLPWRPAEGR 310
Query: 93 KAC 95
+
Sbjct: 311 NSN 313
Score = 51.7 bits (123), Expect = 2e-09
Identities = 21/88 (23%), Positives = 31/88 (35%), Gaps = 9/88 (10%)
Query: 9 GSDKESGGEHLKKFRCSSRDRIFFQTCNCNNHARKCRFNMELYKLSGRSSGGVCLQCRHF 68
G + + + LK + + D C CN HA +C N + C+H
Sbjct: 229 GDEVFNEPKVLKSYYYAISDFAVGGRCKCNGHASECVKN---------EFDKLMCNCKHN 279
Query: 69 TAGRHCHYCKEGYYRDPSRPITHRKACK 96
T G C C + P R T A +
Sbjct: 280 TYGVDCEKCLPFFNDRPWRRATAESASE 307
Score = 49.1 bits (116), Expect = 2e-08
Identities = 18/70 (25%), Positives = 25/70 (35%), Gaps = 6/70 (8%)
Query: 25 SSRDRIFFQTCNCNNHARKCRFNMELYKLSGRSSGGVCLQCRHFTAGRHCHYCKEGYYRD 84
S +D C C+ HA C + C+H T G C C G+ +
Sbjct: 256 SIKDISIGGRCVCHGHADVCDAK------DPLDPFRLQCACQHNTCGGSCDRCCPGFNQQ 309
Query: 85 PSRPITHRKA 94
P +P T A
Sbjct: 310 PWKPATTDSA 319
Score = 37.5 bits (86), Expect = 2e-04
Identities = 17/64 (26%), Positives = 23/64 (35%), Gaps = 10/64 (15%)
Query: 27 RDRIFFQTCNCNNHARKCRFNMELYKLSGRSSGGVCLQCRHFTAGRHCHYCKEGYYRDPS 86
D C CN HA C ++ + +C H T G C CK+ Y P
Sbjct: 289 SDIKVRGRCKCNLHATVCVYDN----------SKLTCECEHNTTGPDCGKCKKNYQGRPW 338
Query: 87 RPIT 90
P +
Sbjct: 339 SPGS 342
