Diaphorina citri psyllid: psy12863


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
RYVLRNSVHCFSYIDNNLHITNWKRSLGCKCQYRHVVDWCGCSPNDFRSSDYSRLVATKGKQLYFARKFEPVVNQDIHLEVSSSYDQKEQMSRDFLHAIGPYSEPVLIHEWLTLVTHNITYLWIDPTNVLAAVTRVQVDENTTSITQSSQ
cEEEcccccccccccccEEEEEEcccccccccccEEEECcccccccccccHHHHHHHHccccccEEccccccccHHHEEEEEcccccccHHHHHHHccccccccccEEEEEEEccEEEEEEEEEcccccEEEEEEEEEEccccccccccc
RYVLRNSVHCFSYIDNNLHITNWKRSLGCKCQYRHVVDWCGCSPNDFRSSDYSRLVATKGKQLYFARKFEPVVNQDIHLEVSSSYDQKEQMSRDFLHAIGPYSEPVLIHEWLTLVTHNITYLWIDPTNVLAAVTRVQV************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RYVLRNSVHCFSYIDNNLHITNWKRSLGCKCQYRHVVDWCGCSPNDFRSSDYSRLVATKGKQLYFARKFEPVVNQDIHLEVSSSYDQKEQMSRDFLHAIGPYSEPVLIHEWLTLVTHNITYLWIDPTNVLAAVTRVQVDENTTSITQSSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Xylosyltransferase oxt Catalyzes the first step in biosynthesis of glycosaminoglycan. Transfers D-xylose from UDP-D-xylose to specific serine residues of the core protein. Initial enzyme in the biosynthesis of chondroitin sulfate and dermatan sulfate proteoglycans in fibroblasts and chondrocytes.confidentQ5QQ53
Xylosyltransferase Catalyzes the first step in biosynthesis of glycosaminoglycan. Transfers D-xylose from UDP-D-xylose to specific serine residues of the core protein. Initial enzyme in the biosynthesis of chondroitin sulfate and dermatan sulfate proteoglycans in fibroblasts and chondrocytes.confidentQ5QQ55
Xylosyltransferase 1 Catalyzes the first step in biosynthesis of glycosaminoglycan. Transfers D-xylose from UDP-D-xylose to specific serine residues of the core protein. Initial enzyme in the biosynthesis of chondroitin sulfate and dermatan sulfate proteoglycans in fibroblasts and chondrocytes.confidentQ5QQ57

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0034605 [BP]cellular response to heatprobableGO:0009628, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0009266, GO:0009408, GO:0044699
GO:0050650 [BP]chondroitin sulfate proteoglycan biosynthetic processprobableGO:0030203, GO:0044249, GO:0006807, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:1901576, GO:0044710, GO:0044260, GO:0071704, GO:0009987, GO:0030166, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0043436, GO:0044238, GO:1901564, GO:1901566, GO:0006082, GO:0044272, GO:1901137, GO:1901135, GO:0050654, GO:0043170, GO:0019538, GO:0006029, GO:0006790, GO:0006022, GO:0006023, GO:0006024, GO:0044281
GO:0042732 [BP]D-xylose metabolic processprobableGO:0019321, GO:0044238, GO:0005975, GO:0005996, GO:0071704, GO:0008150, GO:0008152, GO:0044723
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GAK, chain A
Confidence level:confident
Coverage over the Query: 1-77
View the alignment between query and template
View the model in PyMOL