Diaphorina citri psyllid: psy12865


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MKGRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQETYFSSALPLAAPPKSPAKLKSRSNQPNMEDEDNCDRGSLASYGSGNTTDSDKASSLEAKQLWVKRLREVIQETYFSSALPLAAPPKSPASASSLEAKQLWVKRLREVIQETYFSSALPLAAPPKSPAKLKSRSNQPNMEDEDNCDRGSLASYGSGNTTDSDKPLTAC
ccccccccccccEEcccccccEEEEEccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEcccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEcccccccccccccccc
*****M*SELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQETYFSSAL****************************************************QLWVKRLREVIQETYFSSAL******************QLWVKRLREVIQETYFSSA***************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQETYFSSALPLAAPPKSPAKLKSRSNQPNMEDEDNCDRGSLASYGSGNTTDSDKASSLEAKQLWVKRLREVIQETYFSSALPLAAPPKSPASASSLEAKQLWVKRLREVIQETYFSSALPLAAPPKSPAKLKSRSNQPNMEDEDNCDRGSLASYGSGNTTDSDKPLTAC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Kalirin Promotes the exchange of GDP by GTP. Activates specific Rho GTPase family members, thereby inducing various signaling mechanisms that regulate neuronal shape, growth, and plasticity, through their effects on the actin cytoskeleton. Induces lamellipodia independent of its GEF activity.confidentO60229
Kalirin Promotes the exchange of GDP by GTP. Activates specific Rho GTPase family members, thereby inducing various signaling mechanisms that regulate neuronal shape, growth, and plasticity, through their effects on the actin cytoskeleton. Induces lamellipodia independent of its GEF activity. Isoforms 1 and 7 are necessary for neuronal development and axonal outgrowth. Isoform 6 is required for dendritic spine formation.confidentP97924

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007266 [BP]Rho protein signal transductionprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0050789, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0007265, GO:0007264, GO:0035556, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RGN, chain B
Confidence level:confident
Coverage over the Query: 1-81
View the alignment between query and template
View the model in PyMOL
Template: 1FHO, chain A
Confidence level:confident
Coverage over the Query: 144-173
View the alignment between query and template
View the model in PyMOL
Template: 2FJL, chain A
Confidence level:probable
Coverage over the Query: 124-169
View the alignment between query and template
View the model in PyMOL