Psyllid ID: psy12865


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MKGRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQETYFSSALPLAAPPKSPAKLKSRSNQPNMEDEDNCDRGSLASYGSGNTTDSDKASSLEAKQLWVKRLREVIQETYFSSALPLAAPPKSPASASSLEAKQLWVKRLREVIQETYFSSALPLAAPPKSPAKLKSRSNQPNMEDEDNCDRGSLASYGSGNTTDSDKPLTAC
ccccccccccccEEcccccccEEEEEccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEcccccccccccccccc
ccccccccccccEEcccccccEEEEEEcccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccHHHHHHHHHHHcccccccHcHcccccccEEEcccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEcccccccccccccccc
mkgrlmtselgvtehiegdeckfavwtgrapisdCRILLKASSLEAKQLWVKRLREVIQETYfssalplaappkspaklksrsnqpnmededncdrgslasygsgnttdsdkasSLEAKQLWVKRLREVIQETYfssalplaappkspasassLEAKQLWVKRLREVIQETYfssalplaappkspaklksrsnqpnmededncdrgslasygsgnttdsdkpltac
mkgrlmtselgvtehiegdeCKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQETYfssalplaappkspaklksrsnqpnmededncdrGSLASYGsgnttdsdkassLEAKQLWVKRLREVIQETYFssalplaappKSPASASSLEAKQLWVKRLREVIQETYfssalplaappkspaklksrsnqpnmededncdrgslasygsgnttdsdkpltac
MKGRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQETYFssalplaappkspaklksRSNQPNMEDEDNCDRGSLASYGSGNTTDSDKASSLEAKQLWVKRLREVIQETYFssalplaappkspasassleaKQLWVKRLREVIQETYFssalplaappkspaklksRSNQPNMEDEDNCDRGSLASYGSGNTTDSDKPLTAC
**********GVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQETYFSSAL****************************************************QLWVKRLREVIQETYFSSAL******************QLWVKRLREVIQETYFSSA***************************************************
*****M*SELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQE****************************************************************************************************VKRLREVIQETYF******************************************************
MKGRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQETYFSSALPLAA*********************NCDRGSLASYGS***********LEAKQLWVKRLREVIQETYFSSALPL*************EAKQLWVKRLREVIQETYFSSALPLAA*********************NCDRGSLASYGS*************
**GRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQETYFSSALPL***************************GSLASYGSGNTTDSDKASSLEAKQLWVKRLREVIQETYFSSALPLAAPPKSPASASSLEAKQLWVKRLREVIQETYFSSALPL*A*************************G********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQETYFSSALPLAAPPKSPAKLKSRSNQPNMEDEDNCDRGSLASYGSGNTTDSDKASSLEAKQLWVKRLREVIQETYFSSALPLAAPPKSPASASSLEAKQLWVKRLREVIQETYFSSALPLAAPPKSPAKLKSRSNQPNMEDEDNCDRGSLASYGSGNTTDSDKPLTAC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query227 2.2.26 [Sep-21-2011]
P97924 2959 Kalirin OS=Rattus norvegi yes N/A 0.497 0.038 0.504 4e-25
A2CG49 2964 Kalirin OS=Mus musculus G no N/A 0.497 0.038 0.504 4e-25
O60229 2985 Kalirin OS=Homo sapiens G yes N/A 0.497 0.037 0.504 8e-25
Q1LUA6 3028 Triple functional domain no N/A 0.497 0.037 0.512 2e-24
O75962 3097 Triple functional domain no N/A 0.497 0.036 0.5 2e-23
Q0KL02 3102 Triple functional domain no N/A 0.497 0.036 0.5 2e-23
>sp|P97924|KALRN_RAT Kalirin OS=Rattus norvegicus GN=Kalrn PE=1 SV=3 Back     alignment and function desciption
 Score =  114 bits (286), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 81/123 (65%), Gaps = 10/123 (8%)

Query: 2    KGRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQET 61
            K +L+TSELGVTEH+EGD CKFA+W+GR P SD + +LKAS++E KQ W+K +REVIQE 
Sbjct: 1496 KNKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVLKASNIETKQEWIKNIREVIQER 1555

Query: 62   YFSSALPLAAP---PKSPAKLKSRSNQPNMEDEDNCDRG-------SLASYGSGNTTDSD 111
                   L  P   PK+PAKL++ S +  +ED D+   G       S+AS  S NT +SD
Sbjct: 1556 IIHLKGALKEPIQLPKTPAKLRNNSKRDGVEDGDSQGDGSSQPDTISIASRTSQNTVESD 1615

Query: 112  KAS 114
            K S
Sbjct: 1616 KLS 1618




Promotes the exchange of GDP by GTP. Activates specific Rho GTPase family members, thereby inducing various signaling mechanisms that regulate neuronal shape, growth, and plasticity, through their effects on the actin cytoskeleton. Induces lamellipodia independent of its GEF activity. Isoforms 1 and 7 are necessary for neuronal development and axonal outgrowth. Isoform 6 is required for dendritic spine formation.
Rattus norvegicus (taxid: 10116)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|A2CG49|KALRN_MOUSE Kalirin OS=Mus musculus GN=Kalrn PE=1 SV=1 Back     alignment and function description
>sp|O60229|KALRN_HUMAN Kalirin OS=Homo sapiens GN=KALRN PE=1 SV=2 Back     alignment and function description
>sp|Q1LUA6|TRIO_DANRE Triple functional domain protein OS=Danio rerio GN=trio PE=3 SV=1 Back     alignment and function description
>sp|O75962|TRIO_HUMAN Triple functional domain protein OS=Homo sapiens GN=TRIO PE=1 SV=2 Back     alignment and function description
>sp|Q0KL02|TRIO_MOUSE Triple functional domain protein OS=Mus musculus GN=Trio PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query227
328706378 2220 PREDICTED: triple functional domain prot 0.524 0.053 0.731 7e-42
328706380 2247 PREDICTED: triple functional domain prot 0.524 0.052 0.731 8e-42
328706374 2227 PREDICTED: triple functional domain prot 0.524 0.053 0.731 9e-42
328706376 2254 PREDICTED: triple functional domain prot 0.524 0.052 0.731 1e-41
189235153 1604 PREDICTED: similar to AGAP006107-PA [Tri 0.511 0.072 0.698 1e-39
270003787 2475 hypothetical protein TcasGA2_TC003063 [T 0.484 0.044 0.725 3e-39
242007895 2251 Huntingtin-associated protein-interactin 0.511 0.051 0.693 2e-38
340715586 3145 PREDICTED: triple functional domain prot 0.506 0.036 0.623 1e-33
350396743 3149 PREDICTED: triple functional domain prot 0.506 0.036 0.623 2e-33
328789247 3087 PREDICTED: triple functional domain prot 0.506 0.037 0.623 2e-33
>gi|328706378|ref|XP_003243074.1| PREDICTED: triple functional domain protein-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  176 bits (446), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 103/123 (83%), Gaps = 4/123 (3%)

Query: 2    KGRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQET 61
            K +LMTSELGVTEHIEGDECKFAVWTGRAPISD RI+LKAS+LEAKQ WVK+LREVIQET
Sbjct: 1522 KNKLMTSELGVTEHIEGDECKFAVWTGRAPISDYRIVLKASTLEAKQTWVKKLREVIQET 1581

Query: 62   YFSSALPLAAPPKSPAKLKSRSNQPNME-DEDNCDRGSLASYGSGNTTDSDKASSLEAKQ 120
            YF+SAL +   PKSPAKLK  S + + + +E+N DRGSLAS+GSGNTTDSDK S +E   
Sbjct: 1582 YFNSALRMYM-PKSPAKLKPDSQRSSRDLEEENLDRGSLASFGSGNTTDSDKNSGVEMT- 1639

Query: 121  LWV 123
             WV
Sbjct: 1640 -WV 1641




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328706380|ref|XP_003243075.1| PREDICTED: triple functional domain protein-like isoform 4 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328706374|ref|XP_003243072.1| PREDICTED: triple functional domain protein-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328706376|ref|XP_003243073.1| PREDICTED: triple functional domain protein-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|189235153|ref|XP_968509.2| PREDICTED: similar to AGAP006107-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270003787|gb|EFA00235.1| hypothetical protein TcasGA2_TC003063 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242007895|ref|XP_002424753.1| Huntingtin-associated protein-interacting protein, putative [Pediculus humanus corporis] gi|212508256|gb|EEB12015.1| Huntingtin-associated protein-interacting protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340715586|ref|XP_003396292.1| PREDICTED: triple functional domain protein-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350396743|ref|XP_003484649.1| PREDICTED: triple functional domain protein-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328789247|ref|XP_003251251.1| PREDICTED: triple functional domain protein [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query227
FB|FBgn0024277 2263 trio "trio" [Drosophila melano 0.528 0.053 0.527 5e-27
ZFIN|ZDB-GENE-100921-4 1612 kalrna "kalirin, RhoGEF kinase 0.497 0.070 0.455 2.4e-19
UNIPROTKB|I3L9H1528 LOC100737382 "Uncharacterized 0.497 0.214 0.459 3.5e-19
UNIPROTKB|F1PUI1 2201 KALRN "Uncharacterized protein 0.497 0.051 0.447 5.1e-19
UNIPROTKB|F1MXJ6 2941 KALRN "Uncharacterized protein 0.497 0.038 0.447 9.7e-19
UNIPROTKB|F1PPJ4 2945 KALRN "Uncharacterized protein 0.497 0.038 0.447 9.7e-19
UNIPROTKB|H7BXZ5 2955 KALRN "Kalirin" [Homo sapiens 0.497 0.038 0.447 1.2e-18
UNIPROTKB|O60229 2985 KALRN "Kalirin" [Homo sapiens 0.497 0.037 0.447 1.3e-18
UNIPROTKB|J3QSW6 2986 KALRN "Kalirin" [Homo sapiens 0.497 0.037 0.447 1.3e-18
UNIPROTKB|I3L8211406 KALRN "Uncharacterized protein 0.506 0.081 0.448 1.8e-18
FB|FBgn0024277 trio "trio" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 320 (117.7 bits), Expect = 5.0e-27, P = 5.0e-27
 Identities = 67/127 (52%), Positives = 89/127 (70%)

Query:     2 KGRLMTSELGVTEHIEGDECKFAVWTGRAP-ISDCRILLKASSLEAKQLWVKRLREVIQE 60
             K +LMT+++G+TEHIEGDE KFAVWTGR+P +SDCRI+LKA+SLE KQ+WVK+LREV+QE
Sbjct:  1523 KSKLMTTDMGITEHIEGDETKFAVWTGRSPMLSDCRIVLKATSLETKQIWVKKLREVMQE 1582

Query:    61 TYFXXXXXXXXXXXXXXXXXXRSNQPNMED---EDNCDRGSLASYGSGNTTDSD-KASSL 116
             T F                  + +  ++++   E++ DR SLAS+GSGNTTDSD K  + 
Sbjct:  1583 TCFSGTSLTLPKSPAKHSGSSQRSSRDLDEQLTENDHDRCSLASFGSGNTTDSDNKLGNQ 1642

Query:   117 EAKQLWV 123
             EA   WV
Sbjct:  1643 EAT--WV 1647


GO:0005089 "Rho guanyl-nucleotide exchange factor activity" evidence=ISS;IDA;NAS
GO:0007422 "peripheral nervous system development" evidence=IGI;IMP
GO:0007411 "axon guidance" evidence=IGI;IMP;TAS
GO:0007417 "central nervous system development" evidence=IGI;IMP
GO:0030036 "actin cytoskeleton organization" evidence=IEP;IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0007266 "Rho protein signal transduction" evidence=IDA
GO:0035023 "regulation of Rho protein signal transduction" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005543 "phospholipid binding" evidence=IEA
GO:0050770 "regulation of axonogenesis" evidence=IGI
GO:0016319 "mushroom body development" evidence=IMP
GO:0048675 "axon extension" evidence=IMP
GO:0045887 "positive regulation of synaptic growth at neuromuscular junction" evidence=IMP
GO:0071772 "response to BMP stimulus" evidence=IGI
GO:0007412 "axon target recognition" evidence=IGI
GO:0007480 "imaginal disc-derived leg morphogenesis" evidence=IMP
GO:0046331 "lateral inhibition" evidence=IMP
ZFIN|ZDB-GENE-100921-4 kalrna "kalirin, RhoGEF kinase a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3L9H1 LOC100737382 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PUI1 KALRN "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MXJ6 KALRN "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PPJ4 KALRN "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|H7BXZ5 KALRN "Kalirin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O60229 KALRN "Kalirin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3QSW6 KALRN "Kalirin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L821 KALRN "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O60229KALRN_HUMAN2, ., 7, ., 1, 1, ., 10.50400.49770.0378yesN/A
P97924KALRN_RAT2, ., 7, ., 1, 1, ., 10.50400.49770.0381yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query227
cd13240123 cd13240, PH1_Kalirin_Trio_like, Triple functional 3e-35
cd01227132 cd01227, PH_Dbs, DBL's big sister protein pleckstr 2e-07
cd13239125 cd13239, PH_Obscurin, Obscurin pleckstrin homology 2e-07
cd13240123 cd13240, PH1_Kalirin_Trio_like, Triple functional 3e-07
cd13240123 cd13240, PH1_Kalirin_Trio_like, Triple functional 5e-06
cd13242136 cd13242, PH_puratrophin-1, Puratrophin-1 pleckstri 1e-04
cd13241140 cd13241, PH2_Kalirin_Trio_p63RhoGEF, p63RhoGEF ple 1e-04
>gnl|CDD|241394 cd13240, PH1_Kalirin_Trio_like, Triple functional domain pleckstrin homology pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
 Score =  121 bits (305), Expect = 3e-35
 Identities = 47/61 (77%), Positives = 52/61 (85%)

Query: 2   KGRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQET 61
           K +LMTSELGVTEHIEGD CKFA+WTGR P SD +I+LKASSLE KQ WVK+LREVIQE 
Sbjct: 63  KSKLMTSELGVTEHIEGDPCKFALWTGRVPTSDNKIVLKASSLEVKQEWVKKLREVIQER 122

Query: 62  Y 62
            
Sbjct: 123 I 123


RhoGEFs, Kalirin and Trio, the mammalian homologs of Drosophila Trio and Caenorhabditis elegans UNC-73 regulate a novel step in secretory granule maturation. Their signaling modulates the extent to which regulated cargo enter and remain in the regulated secretory pathway. This allows for fine tuning of peptides released by a single secretory cell type with impaired signaling leading to pathological states. Trio plays an essential role in regulating the actin cytoskeleton during axonal guidance and branching. Kalirin and Trio are encoded by separate genes in mammals and by a single one in invertebrates. Kalirin and Trio share the same complex multidomain structure and display several splice variants. The longest Kalirin and Trio proteins have a Sec14 domain, a stretch of spectrin repeats, a RhoGEF(DH)/PH cassette (also called GEF1), an SH3 domain, a second RhoGEF(DH)/PH cassette (also called GEF2), a second SH3 domain, Ig/FNIII domains, and a kinase domain. The first RhoGEF(DH)/PH cassette catalyzes exchange on Rac1 and RhoG while the second RhoGEF(DH)/PH cassette is specific for RhoA. Kalirin and Trio are closely related to p63RhoGEF and have PH domains of similar function. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinases, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, cytoskeletal associated molecules, and in lipid associated enzymes. Length = 123

>gnl|CDD|241261 cd01227, PH_Dbs, DBL's big sister protein pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241393 cd13239, PH_Obscurin, Obscurin pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241394 cd13240, PH1_Kalirin_Trio_like, Triple functional domain pleckstrin homology pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241394 cd13240, PH1_Kalirin_Trio_like, Triple functional domain pleckstrin homology pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241396 cd13242, PH_puratrophin-1, Puratrophin-1 pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241395 cd13241, PH2_Kalirin_Trio_p63RhoGEF, p63RhoGEF pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 227
KOG4240|consensus1025 99.89
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 99.83
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 99.82
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 99.4
KOG0689|consensus448 99.34
KOG4240|consensus1025 99.19
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 96.8
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 96.63
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 96.51
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 96.46
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 96.14
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 95.96
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 95.8
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 95.6
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 95.32
cd01223116 PH_Vav Vav pleckstrin homology (PH) domain. Vav pl 95.27
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 95.22
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 95.13
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 94.97
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 94.95
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 94.57
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 94.48
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 94.16
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 93.58
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 93.25
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 93.23
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 92.62
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 92.46
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 92.2
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 92.12
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 91.95
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 91.57
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 90.74
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 89.78
PF15405135 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. 89.54
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 89.05
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 88.08
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 86.86
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 86.57
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 86.31
PF1540989 PH_8: Pleckstrin homology domain 85.99
KOG3518|consensus521 84.31
cd01255160 PH_TIAM TIAM Pleckstrin homology (PH) domain. TIAM 81.81
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 81.69
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 81.44
>KOG4240|consensus Back     alignment and domain information
Probab=99.89  E-value=6.4e-24  Score=216.09  Aligned_cols=131  Identities=37%  Similarity=0.476  Sum_probs=118.4

Q ss_pred             CCCccccccccceeeccCCceeEEEecCCCCCCCceEEEEcCCHHHHHHHHHHHHHHHHhh--ccccCCCCCCCCCCccc
Q psy12865          1 MKGRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQET--YFSSALPLAAPPKSPAK   78 (227)
Q Consensus         1 yK~slk~s~lGltE~VegD~~kFeiW~~r~~~s~~~~iLQAss~evK~~Wvk~IreiL~~q--~l~~alp~~~~~ks~~~   78 (227)
                      ||++++|+++||||||+||+|||+||.|+.+.   .|+|||+++++|+.|+++||+++++|  .+.+.-|.. .++++.+
T Consensus       874 ~~~~l~~~e~gite~v~Gd~~kf~~~~g~~~~---~~~~~a~~~~~K~~W~~~ir~~~~~~~~~~~~~~~~~-~~~~~~~  949 (1025)
T KOG4240|consen  874 SKKKLPMSEVGITEHVEGDPCKFELWVGRTES---VIDLKASNHETKQKWVKEIREVLQERTILLKGKEQAQ-ALETLDK  949 (1025)
T ss_pred             hhccCCHHhhcchhhcccCceEEEEeccCCCc---ceeeecCCcchhhhhccchHHHHHHHHHHhhhhhhhh-ccccccc
Confidence            57779999999999999999999999999765   79999999999999999999999999  455533777 7777778


Q ss_pred             cccCCCCCC-------CCCCCCCcccceeecCCCCCCCcccccc---chhccccc--ceEEEEecceEEEecCCCCCC
Q psy12865         79 LKSRSNQPN-------MEDEDNCDRGSLASYGSGNTTDSDKASS---LEAKQLWV--KRLREVIQETYFSSALPLAAP  144 (227)
Q Consensus        79 ~~~~s~r~~-------~~~~s~~d~~sl~s~~s~n~~ds~k~~~---v~~d~~a~--~elsv~~gqtve~le~~~~~p  144 (227)
                      .++.++|++       ++..+||+|+++++|+|+|++||++.+.   |.+||.++  +||         ++|+|+..|
T Consensus       950 ~~~~~~~~~~~~~~~~~~~~sq~~~~~~~~r~~~~~~~s~~~~~~~~~~~~~~~s~~~~l---------~~~~~~~~~ 1018 (1025)
T KOG4240|consen  950 ARSKLPRSGAEDLGSQGNFSSQPETISIASRTSVNSCDSEKSSEVTIVTADFDTSVSAEL---------IVERPHTDP 1018 (1025)
T ss_pred             cccCCCCCchhccccccccccCCchhcccccccccccccccCCCcceeccCCccCcchhh---------ccccCCCCC
Confidence            999999998       4678999999999999999999999887   99999999  788         999999988



>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0689|consensus Back     alignment and domain information
>KOG4240|consensus Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01223 PH_Vav Vav pleckstrin homology (PH) domain Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>KOG3518|consensus Back     alignment and domain information
>cd01255 PH_TIAM TIAM Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query227
2nz8_B313 N-Terminal Dhph Cassette Of Trio In Complex With Nu 2e-19
1nty_A311 Crystal Structure Of The First DhPH DOMAIN OF TRIO 2e-19
>pdb|2NZ8|B Chain B, N-Terminal Dhph Cassette Of Trio In Complex With Nucleotide- Free Rac1 Length = 313 Back     alignment and structure

Iteration: 1

Score = 92.4 bits (228), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 41/59 (69%), Positives = 49/59 (83%) Query: 2 KGRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQE 60 K +L TSELGVTEH+EGD CKFA+W GR P SD +I+LKASS+E KQ W+K +REVIQE Sbjct: 253 KSKLFTSELGVTEHVEGDPCKFALWVGRTPTSDNKIVLKASSIENKQDWIKHIREVIQE 311
>pdb|1NTY|A Chain A, Crystal Structure Of The First DhPH DOMAIN OF TRIO TO 1.7 A Length = 311 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query227
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 2e-16
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 4e-14
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 1e-11
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 4e-10
1foe_A377 T-lymphoma invasion and metastasis inducing protei 3e-07
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 3e-07
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 9e-07
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 3e-05
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 7e-05
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 1e-04
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Length = 311 Back     alignment and structure
 Score = 75.6 bits (186), Expect = 2e-16
 Identities = 41/59 (69%), Positives = 49/59 (83%)

Query: 2   KGRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQE 60
           K +L TSELGVTEH+EGD CKFA+W GR P SD +I+LKASS+E KQ W+K +REVIQE
Sbjct: 251 KSKLFTSELGVTEHVEGDPCKFALWVGRTPTSDNKIVLKASSIENKQDWIKHIREVIQE 309


>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Length = 354 Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Length = 353 Back     alignment and structure
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Length = 119 Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Length = 377 Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Length = 402 Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Length = 354 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query227
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 99.59
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 99.06
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 98.83
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 98.6
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 98.54
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 98.25
1u3o_A82 Huntingtin-associated protein-interacting protein; 98.16
1foe_A377 T-lymphoma invasion and metastasis inducing protei 98.12
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 97.86
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 97.72
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 97.65
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 97.54
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 97.5
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 97.31
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 97.28
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 97.04
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 97.02
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 97.01
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 96.82
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 95.98
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 95.91
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 95.84
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 95.83
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 95.58
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 95.55
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 95.51
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 95.49
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 95.4
3rcp_A103 Pleckstrin homology domain-containing family A ME; 95.29
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 95.21
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 95.14
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 95.03
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 94.97
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 94.87
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 94.78
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 94.71
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 94.64
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 94.59
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 94.58
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 94.2
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 94.17
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 94.16
3cxb_B112 Pleckstrin homology domain-containing family M mem 94.16
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 94.05
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 94.01
2yry_A122 Pleckstrin homology domain-containing family A mem 93.97
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 93.96
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 93.91
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 93.84
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 93.66
1v88_A130 Oxysterol binding protein-related protein 8; vesic 93.61
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 93.58
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 93.43
2dkp_A128 Pleckstrin homology domain-containing family A mem 93.24
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 93.13
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 93.08
2d9y_A117 Pleckstrin homology domain-containing protein fami 93.06
2d9v_A130 Pleckstrin homology domain-containing protein fami 93.05
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 92.93
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 92.85
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 92.72
3aj4_A112 Pleckstrin homology domain-containing family B ME; 92.7
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 92.17
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 92.09
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 91.89
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 91.57
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 91.23
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 90.93
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 90.91
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 90.66
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 90.15
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 89.94
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 89.9
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 89.62
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 89.45
1v5p_A126 Pleckstrin homology domain-containing, family A; T 89.4
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 89.27
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 89.1
1wxb_A68 Epidermal growth factor receptor pathway substrate 88.81
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 88.74
1uti_A58 GRB2-related adaptor protein 2; signaling protein 88.71
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 88.66
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 88.64
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 88.48
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 88.41
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 88.25
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 88.19
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 88.13
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 88.12
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 88.07
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 87.93
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 87.85
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 87.84
1i07_A60 Epidermal growth factor receptor kinase substrate 87.81
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 87.76
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 87.73
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 87.72
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 87.68
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 87.65
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 87.65
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 87.54
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 87.46
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 87.4
2dil_A69 Proline-serine-threonine phosphatase-interacting p 87.33
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 87.32
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 87.29
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 87.26
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 87.15
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 87.12
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 87.1
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 87.09
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 87.01
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 86.91
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 86.9
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 86.88
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 86.83
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 86.83
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 86.63
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 86.63
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 86.61
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 86.6
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 86.59
2j6f_A62 CD2-associated protein; metal-binding, immune resp 86.56
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 86.52
2da9_A70 SH3-domain kinase binding protein 1; structural ge 86.51
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 86.48
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 86.43
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 86.34
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 86.32
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 86.28
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 86.08
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 86.07
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 86.03
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 86.02
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 85.96
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 85.91
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 85.91
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 85.7
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 85.65
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 85.63
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 85.6
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 85.53
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 85.5
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 85.48
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 85.4
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 85.39
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 85.38
1wi1_A126 Calcium-dependent activator protein for secretion, 85.37
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 85.36
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 85.35
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 85.33
1wfw_A74 Kalirin-9A; SH3 domain, neuron-specific GDP/GTP ex 85.3
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 85.27
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 85.24
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 85.23
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 85.1
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 85.07
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 84.89
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 84.83
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 84.72
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 84.71
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 84.67
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 84.66
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 84.6
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 84.6
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 84.59
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 84.57
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 84.56
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 84.46
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 84.45
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 84.44
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 84.4
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 84.4
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 84.29
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 84.26
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 84.22
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 84.02
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 83.83
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 83.82
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 83.81
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 83.81
2cuc_A70 SH3 domain containing ring finger 2; structural ge 83.81
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 83.79
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 83.79
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 83.77
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 83.72
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 83.71
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 83.57
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 83.52
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 83.5
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 83.48
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 83.08
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 83.06
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 82.94
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 82.94
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 82.86
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 82.81
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 82.71
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 82.62
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 82.55
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 82.46
1awj_A77 ITK; transferase, regulatory intramolecular comple 82.38
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 82.34
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 82.28
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 82.26
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 82.19
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 82.19
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 82.02
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 81.69
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 81.63
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 81.47
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 81.46
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 81.39
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 81.38
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 81.35
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 81.09
3u23_A65 CD2-associated protein; structural genomics, struc 81.03
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 80.68
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 80.57
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 80.14
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 80.11
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Back     alignment and structure
Probab=99.59  E-value=1.5e-16  Score=126.67  Aligned_cols=57  Identities=14%  Similarity=0.225  Sum_probs=51.7

Q ss_pred             CCCccccccccceeecc-CCceeEEEecCCCCCCCceEEE--EcCCHH-HHHHHHHHHHHHHHhh
Q psy12865          1 MKGRLMTSELGVTEHIE-GDECKFAVWTGRAPISDCRILL--KASSLE-AKQLWVKRLREVIQET   61 (227)
Q Consensus         1 yK~slk~s~lGltE~Ve-gD~~kFeiW~~r~~~s~~~~iL--QAss~e-vK~~Wvk~IreiL~~q   61 (227)
                      ||++|+|+++||||+++ ||+|+|+||+++++   +.|+|  ||+|+| +|++|+++|++ ++++
T Consensus        53 ~K~~ikl~~~~lte~~~~~d~~kFeiw~~~~~---~~~il~~qA~s~e~~K~~Wv~~I~~-~~~~  113 (119)
T 1fho_A           53 HYSSIRLDKYNIRQHTTDEDTIVLQPQEPGLP---SFRIKPKDFETSEYVRKAWLRDIAE-EQEK  113 (119)
T ss_dssp             SCCEEESSSCEEEEECTTCCEEEEECCSTTCC---CBCCCCCSSSSCSHHHHHHHHHHHT-CCHH
T ss_pred             EeeEEeeceeEEEecCCCCCCcEEEEccCCCC---ceEEEeeecCCcHHHHHHHHHHHHH-HHHH
Confidence            89999999999999999 99999999988854   37999  999999 99999999999 4443



>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>1wfw_A Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 227
d1ntya2121 b.55.1.1 (A:1415-1535) Triple functional domain pr 2e-13
d1fhoa_119 b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis ele 5e-13
d1kz7a2147 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse 9e-10
d1txda2114 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exch 2e-07
d1v61a_132 b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (M 2e-05
d1xcga2140 b.55.1.1 (A:942-1081) Rho guanine nucleotide excha 2e-05
d1dbha2133 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {H 1e-04
d1ki1b2142 b.55.1.1 (B:1439-1580) GEF of intersectin {Human ( 6e-04
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: Triple functional domain protein TRIO
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 62.3 bits (151), Expect = 2e-13
 Identities = 41/59 (69%), Positives = 49/59 (83%)

Query: 2   KGRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQE 60
           K +L TSELGVTEH+EGD CKFA+W GR P SD +I+LKASS+E KQ W+K +REVIQE
Sbjct: 61  KSKLFTSELGVTEHVEGDPCKFALWVGRTPTSDNKIVLKASSIENKQDWIKHIREVIQE 119


>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 119 Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Length = 147 Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Length = 132 Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 142 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query227
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 99.2
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 99.19
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 99.16
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 99.06
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 97.95
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 97.9
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 97.81
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 97.75
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 97.52
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 97.11
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 95.78
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 95.54
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 95.54
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 95.31
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 94.84
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 94.78
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 94.63
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 94.44
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 94.05
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 93.95
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 93.93
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 93.91
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 93.68
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 93.62
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 93.29
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 93.26
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 93.15
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 93.15
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 92.99
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 92.66
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 92.56
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 92.55
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 92.4
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 92.38
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 92.32
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 92.32
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 92.26
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 92.13
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 92.13
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 92.11
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 92.02
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 91.97
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 91.95
d1wi1a_126 Calcium-dependent activator protein for secretion, 91.81
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 91.79
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 91.64
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 91.61
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 91.59
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 91.45
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 91.43
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.35
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 91.33
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 91.28
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 91.27
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 91.14
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 91.11
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 90.94
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 90.93
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 90.6
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 90.6
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 90.43
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 90.39
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 90.39
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 90.29
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 90.18
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 89.94
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 89.26
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 89.24
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 89.21
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 89.05
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 89.02
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 88.94
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 88.85
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 88.84
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 88.7
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 88.62
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 87.98
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 87.89
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 87.58
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 87.35
d1foea2162 GEF of TIAM1 (T-Lymphoma invasion and metastasis i 87.21
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 86.87
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 86.61
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 86.53
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 84.88
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 84.02
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 83.4
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 83.18
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 82.0
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 81.09
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 80.08
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: Dbl's big sister, Dbs
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.20  E-value=5.1e-12  Score=99.82  Aligned_cols=59  Identities=29%  Similarity=0.572  Sum_probs=53.9

Q ss_pred             CCCccccccccceeeccCCceeEEEecCCCCCCCceEEEEcCCHHHHHHHHHHHHHHHHhhc
Q psy12865          1 MKGRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQETY   62 (227)
Q Consensus         1 yK~slk~s~lGltE~VegD~~kFeiW~~r~~~s~~~~iLQAss~evK~~Wvk~IreiL~~q~   62 (227)
                      ||+++.++++++++++++|+++|+||.++..   ..|+|+|+|+|.|++|+++|+++|++|.
T Consensus        73 ~k~~~~~~~~~v~~~~~~~~~~f~~~~~~~~---~~~~l~a~s~eeK~~W~~~I~~~l~~q~  131 (147)
T d1kz7a2          73 YKQSLNMTAVGITENVKGDTKKFEIWYNARE---EVYIIQAPTPEIKAAWVNAIRKVLTSQL  131 (147)
T ss_dssp             EEEEEEGGGEEEECCBTTBTTEEEEEETTTT---EEEEEECSSHHHHHHHHHHHHHHHHHHH
T ss_pred             EeeEEecCCceeEecCCCCcceEEEEeCCCC---cEEEEEeCCHHHHHHHHHHHHHHHHHHH
Confidence            5778899999999999999999999987643   4699999999999999999999999993



>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1foea2 b.55.1.1 (A:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure