Diaphorina citri psyllid: psy12876


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MIKYGLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDIISARFFSDWFIDKARLNNNSFASRDDLYKSLIQNYPNVMSYPNKLGFEQIYLFK
cccccccccEEEEEEEEccccEEEEEEEcccccEEEEECccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHccccccccEECcccccccEEEEEcc
**KYGLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDIISARFFSDWFIDKARLNNNSFASRDDLYKSLIQNYPNVMSYPNKLGFEQIYLFK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKYGLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDIISARFFSDWFIDKARLNNNSFASRDDLYKSLIQNYPNVMSYPNKLGFEQIYLFK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006760 [BP]folic acid-containing compound metabolic processprobableGO:0006732, GO:0019752, GO:0006807, GO:0044281, GO:1901360, GO:0044710, GO:0051186, GO:0006520, GO:0042558, GO:0071704, GO:1901605, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0043436, GO:0046483, GO:0044238, GO:1901564, GO:0006575, GO:0006082, GO:0044237
GO:0008242 [MF]omega peptidase activityprobableGO:0016787, GO:0003824, GO:0008238, GO:0070011, GO:0003674, GO:0008233

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1L9X, chain A
Confidence level:very confident
Coverage over the Query: 5-115
View the alignment between query and template
View the model in PyMOL