Psyllid ID: psy12876

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MIKYGLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDIISARFFSDWFIDKARLNNNSFASRDDLYKSLIQNYPNVMSYPNKLGFEQIYLFK
cccccccccEEEEEEEEccccEEEEEEEcccccEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccccEEEcccccccEEEEEcc
ccHHHHHHHEEEEEEEEccccEEEEEEEEccccEEEEcccccHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcHHHcccEEcccccccEEEEEEEc
MIKYGLTETWNILTLskykswefvstvehkeypivgiqfhpeknayewtesqhnphshddiisarfFSDWFIdkarlnnnsfasrDDLYKSLIQnypnvmsypnklgfeqiylfk
mikygltetwniltlskYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDIISARFFSDWFIDKARLNNNSFASRDDLYKSLIQNypnvmsypnklgfeqiylfk
MIKYGLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDIISARFFSDWFIDKARLNNNSFASRDDLYKSLIQNYPNVMSYPNKLGFEQIYLFK
**KYGLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTE******SHDDIISARFFSDWFIDKARLNNNSFASRDDLYKSLIQNYPNVMSYPNKLGFEQIYLF*
****GLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDIISARFFSDWFIDKAR**********DLYKSLIQNYPNVMSYPNKLGFEQIYLFK
MIKYGLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEW********SHDDIISARFFSDWFIDKARLNNNSFASRDDLYKSLIQNYPNVMSYPNKLGFEQIYLFK
MIKYGLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDIISARFFSDWFIDKARLNNNSFASRDDLYKSLIQNYPNVMSYPNKLGFEQIYLFK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKYGLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDIISARFFSDWFIDKARLNNNSFASRDDLYKSLIQNYPNVMSYPNKLGFEQIYLFK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query115 2.2.26 [Sep-21-2011]
Q54HL4347 Gamma-glutamyl hydrolase yes N/A 0.939 0.311 0.363 6e-13
Q92820318 Gamma-glutamyl hydrolase yes N/A 0.939 0.339 0.339 1e-12
A7YWG4318 Gamma-glutamyl hydrolase yes N/A 0.939 0.339 0.339 5e-11
Q54LN4317 Gamma-glutamyl hydrolase no N/A 0.8 0.290 0.391 9e-11
P93164342 Gamma-glutamyl hydrolase yes N/A 0.947 0.318 0.333 5e-10
O65355347 Gamma-glutamyl hydrolase no N/A 0.773 0.256 0.387 8e-10
Q62867317 Gamma-glutamyl hydrolase yes N/A 0.939 0.340 0.311 4e-09
Q9Z0L8317 Gamma-glutamyl hydrolase yes N/A 0.939 0.340 0.302 1e-08
>sp|Q54HL4|GGHB_DICDI Gamma-glutamyl hydrolase B OS=Dictyostelium discoideum GN=gghB PE=3 SV=1 Back     alignment and function desciption
 Score = 72.8 bits (177), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 67/110 (60%), Gaps = 2/110 (1%)

Query: 6   LTETWNILTLSKYKSW-EFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDIISA 64
           L + +N+L  +  KS  EF+S +E K+YPI  I +HPEK+ Y W       HS + I++ 
Sbjct: 205 LNQFFNVLATNNDKSGNEFISLIESKDYPIYAIIWHPEKSPYSWYSKDATDHSFNAILAC 264

Query: 65  RFFSDWFIDKARLNNNSFASRDDLYKSLIQNYPNVMSYPNKLGFEQIYLF 114
           ++ S++F+++ R +N+ F   + L+KSLI NY    ++  +   EQIY+F
Sbjct: 265 QYMSNFFVNETRKSNHKFNDEEVLFKSLIYNYNPTYTFK-ETHVEQIYIF 313

Dictyostelium discoideum (taxid: 44689)
EC: 3EC: .EC: 4EC: .EC: 1EC: 9EC: .EC: 9
>sp|Q92820|GGH_HUMAN Gamma-glutamyl hydrolase OS=Homo sapiens GN=GGH PE=1 SV=2 Back     alignment and function description
>sp|A7YWG4|GGH_BOVIN Gamma-glutamyl hydrolase OS=Bos taurus GN=GGH PE=2 SV=1 Back     alignment and function description
>sp|Q54LN4|GGHA_DICDI Gamma-glutamyl hydrolase A OS=Dictyostelium discoideum GN=gghA PE=3 SV=1 Back     alignment and function description
>sp|P93164|GGH_SOYBN Gamma-glutamyl hydrolase OS=Glycine max PE=2 SV=1 Back     alignment and function description
>sp|O65355|GGH_ARATH Gamma-glutamyl hydrolase OS=Arabidopsis thaliana GN=GGH PE=1 SV=2 Back     alignment and function description
>sp|Q62867|GGH_RAT Gamma-glutamyl hydrolase OS=Rattus norvegicus GN=Ggh PE=1 SV=1 Back     alignment and function description
>sp|Q9Z0L8|GGH_MOUSE Gamma-glutamyl hydrolase OS=Mus musculus GN=Ggh PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
170041579 362 gamma-glutamyl hydrolase [Culex quinquef 0.982 0.312 0.421 1e-20
158296287 377 AGAP006670-PA [Anopheles gambiae str. PE 1.0 0.305 0.405 2e-20
157127101 354 gamma-glutamyl hydrolase, putative [Aede 1.0 0.324 0.396 8e-20
157127099 376 gamma-glutamyl hydrolase, putative [Aede 1.0 0.305 0.396 8e-20
157127097 375 gamma-glutamyl hydrolase, putative [Aede 1.0 0.306 0.396 8e-20
326741704 314 gamma-glutamyl hydrolase-like precursor 0.878 0.321 0.490 3e-19
307184425 349 Gamma-glutamyl hydrolase [Camponotus flo 0.956 0.315 0.405 6e-19
328720183 308 PREDICTED: gamma-glutamyl hydrolase A-li 0.930 0.347 0.463 8e-19
239790520 314 ACYPI008145 [Acyrthosiphon pisum] 0.878 0.321 0.490 5e-18
328720181 314 PREDICTED: gamma-glutamyl hydrolase A-li 0.878 0.321 0.490 5e-18
>gi|170041579|ref|XP_001848535.1| gamma-glutamyl hydrolase [Culex quinquefasciatus] gi|167865141|gb|EDS28524.1| gamma-glutamyl hydrolase [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 73/114 (64%), Gaps = 1/114 (0%)

Query: 3   KYGLTETWNILTLSK-YKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDI 61
           +YGL   W +++ +K +   EF+ST+EHK  P  G+QFHPEKN YEW   ++  HS   I
Sbjct: 217 EYGLDREWRVMSTNKDWNGLEFISTIEHKTLPFYGVQFHPEKNLYEWVRGKNISHSPHAI 276

Query: 62  ISARFFSDWFIDKARLNNNSFASRDDLYKSLIQNYPNVMSYPNKLGFEQIYLFK 115
            +A++F+D+F+++AR N   FAS  D+ K +I N+P   +   +  FEQ YLF+
Sbjct: 277 RAAQYFADFFVNEARQNGQHFASEVDIDKHVIYNFPATFTGLKRSAFEQCYLFE 330

Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|158296287|ref|XP_316706.4| AGAP006670-PA [Anopheles gambiae str. PEST] gi|157016439|gb|EAA11416.4| AGAP006670-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157127101|ref|XP_001654804.1| gamma-glutamyl hydrolase, putative [Aedes aegypti] gi|108884509|gb|EAT48734.1| AAEL000271-PC [Aedes aegypti] Back     alignment and taxonomy information
>gi|157127099|ref|XP_001654803.1| gamma-glutamyl hydrolase, putative [Aedes aegypti] gi|108884508|gb|EAT48733.1| AAEL000271-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|157127097|ref|XP_001654802.1| gamma-glutamyl hydrolase, putative [Aedes aegypti] gi|108884507|gb|EAT48732.1| AAEL000271-PB, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|326741704|ref|NP_001192053.1| gamma-glutamyl hydrolase-like precursor [Acyrthosiphon pisum] gi|239790522|dbj|BAH71816.1| ACYPI008145 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307184425|gb|EFN70834.1| Gamma-glutamyl hydrolase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328720183|ref|XP_001948688.2| PREDICTED: gamma-glutamyl hydrolase A-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|239790520|dbj|BAH71815.1| ACYPI008145 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328720181|ref|XP_003246970.1| PREDICTED: gamma-glutamyl hydrolase A-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
FB|FBgn0263607373 l(3)72Dp "lethal (3) 72Dp" [Dr 0.921 0.284 0.410 2.8e-18
UNIPROTKB|F1NR48321 GGH "Uncharacterized protein" 0.895 0.320 0.415 2.5e-17
DICTYBASE|DDB_G0289365347 gghB "peptidase C26 family pro 0.939 0.311 0.363 2.9e-16
UNIPROTKB|Q92820318 GGH "Gamma-glutamyl hydrolase" 0.939 0.339 0.339 1.3e-14
ZFIN|ZDB-GENE-040426-2615312 ggh "gamma-glutamyl hydrolase 0.782 0.288 0.414 5.7e-14
TAIR|locus:2037573352 GGH3 "gamma-glutamyl hydrolase 0.921 0.301 0.378 1.2e-13
UNIPROTKB|E2QUT9318 GGH "Uncharacterized protein" 0.939 0.339 0.339 1.8e-13
DICTYBASE|DDB_G0286535317 gghA "peptidase C26 family pro 0.8 0.290 0.391 2.3e-13
TAIR|locus:2037583348 GGH1 "gamma-glutamyl hydrolase 0.921 0.304 0.387 6.9e-13
UNIPROTKB|F1RTA3318 GGH "Uncharacterized protein" 0.939 0.339 0.330 1.1e-12
FB|FBgn0263607 l(3)72Dp "lethal (3) 72Dp" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 224 (83.9 bits), Expect = 2.8e-18, P = 2.8e-18
 Identities = 46/112 (41%), Positives = 74/112 (66%)

Query:     6 LTETWNILTLSK-YKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDIISA 64
             L ETW +++L+  +   EF+STVEH +YP  G+QFHPE+  YE+T++   PH+   ++S 
Sbjct:   207 LNETWRVMSLNHDWNGVEFISTVEHIKYPFYGVQFHPEEPLYEFTKTSI-PHTAAAVLSG 265

Query:    65 RFFSDWFIDKARLNNNSFASRDDLYKSLIQNYPNVMSYPNKLG--FEQIYLF 114
             +FF+D+F+ +AR +N SF++  +  ++LI NY     Y + LG  + Q YLF
Sbjct:   266 QFFADFFVSEARESNQSFSNATEQARTLIYNYKP--EYTSILGSSYIQQYLF 315
GO:0008242 "omega peptidase activity" evidence=ISS
GO:0008150 "biological_process" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0006541 "glutamine metabolic process" evidence=IEA
UNIPROTKB|F1NR48 GGH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0289365 gghB "peptidase C26 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q92820 GGH "Gamma-glutamyl hydrolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2615 ggh "gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2037573 GGH3 "gamma-glutamyl hydrolase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUT9 GGH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286535 gghA "peptidase C26 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2037583 GGH1 "gamma-glutamyl hydrolase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1RTA3 GGH "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.19LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
cd01747273 cd01747, GATase1_Glutamyl_Hydrolase, Type 1 glutam 2e-28
PRK14607 534 PRK14607, PRK14607, bifunctional glutamine amidotr 2e-05
PRK05670189 PRK05670, PRK05670, anthranilate synthase componen 5e-05
COG0512191 COG0512, PabA, Anthranilate/para-aminobenzoate syn 6e-05
cd01743184 cd01743, GATase1_Anthranilate_Synthase, Type 1 glu 2e-04
pfam00117186 pfam00117, GATase, Glutamine amidotransferase clas 2e-04
COG0118204 COG0118, HisH, Glutamine amidotransferase [Amino a 0.001
PRK13566720 PRK13566, PRK13566, anthranilate synthase; Provisi 0.001
cd01742181 cd01742, GATase1_GMP_Synthase, Type 1 glutamine am 0.003
PRK07765214 PRK07765, PRK07765, para-aminobenzoate synthase co 0.003
cd01744178 cd01744, GATase1_CPSase, Small chain of the glutam 0.004
>gnl|CDD|153218 cd01747, GATase1_Glutamyl_Hydrolase, Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information 
 Score =  103 bits (259), Expect = 2e-28
 Identities = 41/92 (44%), Positives = 65/92 (70%), Gaps = 1/92 (1%)

Query: 6   LTETWNILTLSKYKSW-EFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDIISA 64
           L++ +N+LT +   +  EF+STVE  +YPI G+Q+HPEKNA+EW +S   PHS + I   
Sbjct: 176 LSDFFNVLTTNDDWNGVEFISTVEAYKYPIYGVQWHPEKNAFEWKKSSSIPHSEEAIRLT 235

Query: 65  RFFSDWFIDKARLNNNSFASRDDLYKSLIQNY 96
           ++F+++F+++AR +NN F S ++  K LI NY
Sbjct: 236 QYFANFFVNEARKSNNRFESAEEETKHLIYNY 267

Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase. gamma-Glutamyl Hydrolase catalyzes the cleavage of the gamma-glutamyl chain of folylpoly-gamma-glutamyl substrates and is a central enzyme in folyl and antifolyl poly-gamma-glutamate metabolism. GATase activity involves the removal of the ammonia group from a glutamate molecule and its subsequent transfer to a specific substrate, thus creating a new carbon-nitrogen group on the substrate. gamma-Glutamyl hydrolases belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 273
>gnl|CDD|237764 PRK14607, PRK14607, bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|235552 PRK05670, PRK05670, anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|223586 COG0512, PabA, Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|153214 cd01743, GATase1_Anthranilate_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>gnl|CDD|215729 pfam00117, GATase, Glutamine amidotransferase class-I Back     alignment and domain information
>gnl|CDD|223196 COG0118, HisH, Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237429 PRK13566, PRK13566, anthranilate synthase; Provisional Back     alignment and domain information
>gnl|CDD|153213 cd01742, GATase1_GMP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>gnl|CDD|181107 PRK07765, PRK07765, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|153215 cd01744, GATase1_CPSase, Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 115
KOG1559|consensus340 99.98
cd01747273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot 99.97
COG0512191 PabA Anthranilate/para-aminobenzoate synthases com 99.38
PLN02347 536 GMP synthetase 99.29
PRK08857193 para-aminobenzoate synthase component II; Provisio 99.27
TIGR00888188 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N 99.25
PRK11366254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; 99.24
PRK08007187 para-aminobenzoate synthase component II; Provisio 99.22
TIGR01368358 CPSaseIIsmall carbamoyl-phosphate synthase, small 99.19
PRK07765214 para-aminobenzoate synthase component II; Provisio 99.19
CHL00197382 carA carbamoyl-phosphate synthase arginine-specifi 99.19
COG2071243 Predicted glutamine amidotransferases [General fun 99.19
PRK05670189 anthranilate synthase component II; Provisional 99.15
PLN02335222 anthranilate synthase 99.15
TIGR00566188 trpG_papA glutamine amidotransferase of anthranila 99.15
PRK00074 511 guaA GMP synthase; Reviewed 99.14
PRK06895190 putative anthranilate synthase component II; Provi 99.13
PRK05637208 anthranilate synthase component II; Provisional 99.13
CHL00101190 trpG anthranilate synthase component 2 99.11
PRK00758184 GMP synthase subunit A; Validated 99.11
PRK06774191 para-aminobenzoate synthase component II; Provisio 99.1
PRK12564360 carbamoyl phosphate synthase small subunit; Review 99.1
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine 99.07
cd01744178 GATase1_CPSase Small chain of the glutamine-depend 99.06
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine ami 99.06
PRK12838354 carbamoyl phosphate synthase small subunit; Review 99.04
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransfe 98.96
PRK14607 534 bifunctional glutamine amidotransferase/anthranila 98.93
PF00117192 GATase: Glutamine amidotransferase class-I; InterP 98.92
PLN02889 918 oxo-acid-lyase/anthranilate synthase 98.9
PRK09522 531 bifunctional glutamine amidotransferase/anthranila 98.9
PRK06186229 hypothetical protein; Validated 98.88
COG0505368 CarA Carbamoylphosphate synthase small subunit [Am 98.87
PF07722217 Peptidase_C26: Peptidase C26; InterPro: IPR011697 98.85
TIGR01815717 TrpE-clade3 anthranilate synthase, alpha proteobac 98.83
PLN02771415 carbamoyl-phosphate synthase (glutamine-hydrolyzin 98.81
cd01746235 GATase1_CTP_Synthase Type 1 glutamine amidotransfe 98.77
PRK13566720 anthranilate synthase; Provisional 98.77
KOG1622|consensus 552 98.75
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 g 98.75
KOG0026|consensus223 98.72
PRK05380533 pyrG CTP synthetase; Validated 98.68
COG0518198 GuaA GMP synthase - Glutamine amidotransferase dom 98.67
PLN02327557 CTP synthase 98.56
TIGR00337525 PyrG CTP synthase. CTP synthase is involved in pyr 98.53
TIGR01823 742 PabB-fungal aminodeoxychorismate synthase, fungal 98.5
PRK13141205 hisH imidazole glycerol phosphate synthase subunit 98.49
PRK13143200 hisH imidazole glycerol phosphate synthase subunit 98.43
PRK13525189 glutamine amidotransferase subunit PdxT; Provision 98.36
PRK09065237 glutamine amidotransferase; Provisional 98.32
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransfe 98.3
PRK13527200 glutamine amidotransferase subunit PdxT; Provision 98.28
PRK06490239 glutamine amidotransferase; Provisional 98.26
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 g 98.24
PRK13170196 hisH imidazole glycerol phosphate synthase subunit 98.22
TIGR03800184 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl 98.21
COG0118204 HisH Glutamine amidotransferase [Amino acid transp 98.19
PRK13181199 hisH imidazole glycerol phosphate synthase subunit 98.19
CHL00188210 hisH imidazole glycerol phosphate synthase subunit 98.19
PRK13146209 hisH imidazole glycerol phosphate synthase subunit 98.12
PRK07567242 glutamine amidotransferase; Provisional 98.1
TIGR01737227 FGAM_synth_I phosphoribosylformylglycinamidine syn 98.01
PRK14004210 hisH imidazole glycerol phosphate synthase subunit 98.0
COG0504533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide 97.93
PRK13152201 hisH imidazole glycerol phosphate synthase subunit 97.91
PRK13142192 hisH imidazole glycerol phosphate synthase subunit 97.9
PRK05665240 amidotransferase; Provisional 97.89
TIGR01855196 IMP_synth_hisH imidazole glycerol phosphate syntha 97.89
PRK08250235 glutamine amidotransferase; Provisional 97.82
KOG0370|consensus 1435 97.81
PRK07053234 glutamine amidotransferase; Provisional 97.78
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) i 97.74
PLN02617 538 imidazole glycerol phosphate synthase hisHF 97.67
KOG1224|consensus 767 97.63
PLN02832248 glutamine amidotransferase subunit of pyridoxal 5' 97.11
PRK05368302 homoserine O-succinyltransferase; Provisional 96.82
PRK03619219 phosphoribosylformylglycinamidine synthase I; Prov 96.73
KOG0623|consensus 541 96.6
KOG2387|consensus585 95.42
KOG3179|consensus245 93.31
PRK01175261 phosphoribosylformylglycinamidine synthase I; Prov 81.34
PF13507259 GATase_5: CobB/CobQ-like glutamine amidotransferas 80.98
>KOG1559|consensus Back     alignment and domain information 
Probab=99.98  E-value=8.9e-33  Score=213.03  Aligned_cols=109  Identities=39%  Similarity=0.673  Sum_probs=100.0

Q ss_pred             cCCCCCCcEEEEEecCC-CCeeEEEEEeCCCcEEEEeecCCCCccccccCCCCCCCHhHHHHHHHHHHHHHHHHHhCCCC
Q psy12876          3 KYGLTETWNILTLSKYK-SWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDIISARFFSDWFIDKARLNNNS   81 (115)
Q Consensus         3 ~~~L~~~f~v~a~s~d~-~~~fv~aie~~~~pi~gvQfHPE~~~~e~~~~~~~~hs~~~~~~~q~l~~fFv~~ar~~~~~   81 (115)
                      +..|.+.|+|+.++.|+ ..+||+++++++||++|+|||||++++|||... +||++++++++|+.+++||++||++.|+
T Consensus       229 N~~Ls~FFnilTT~~D~~~k~fvSTv~~~kYPvtgfQWHPEKnafEWgss~-IpHsedAiqvtqhaA~~lVsEARKs~nr  307 (340)
T KOG1559|consen  229 NPALSSFFNILTTCTDGNSKTFVSTVESKKYPVTGFQWHPEKNAFEWGSSD-IPHSEDAIQVTQHAANYLVSEARKSLNR  307 (340)
T ss_pred             CHHHHHHHhheeeecCCCceEEEEeecceeccceeeeecCccCccccccCC-CCCChhHHHHHHHHHHHHHHHHHhhcCC
Confidence            44677889999999755 789999999999999999999999999999854 9999999999999999999999999999


Q ss_pred             CCCHHHHHhhccccccccccCCCCC--ceeEEEecC
Q psy12876         82 FASRDDLYKSLIQNYPNVMSYPNKL--GFEQIYLFK  115 (115)
Q Consensus        82 f~~~~~~~~~li~n~~~~~~~~~~~--~~~q~Y~f~  115 (115)
                      |+|. ++.+.|||||.|+  |||..  +|+|||+|+
T Consensus       308 p~Se-kvlsnLIYnykPt--Y~Gy~gsg~devYIFt  340 (340)
T KOG1559|consen  308 PESE-KVLSNLIYNYKPT--YCGYAGSGYDEVYIFT  340 (340)
T ss_pred             ccHH-HHHHHHHhccCcc--eeccccCccceEEeeC
Confidence            9885 7788999999999  99944  899999995

>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>PLN02335 anthranilate synthase Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>PRK06895 putative anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] Back     alignment and domain information
>PLN02889 oxo-acid-lyase/anthranilate synthase Back     alignment and domain information
>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06186 hypothetical protein; Validated Back     alignment and domain information
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>KOG1622|consensus Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>KOG0026|consensus Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02327 CTP synthase Back     alignment and domain information
>TIGR00337 PyrG CTP synthase Back     alignment and domain information
>TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK07567 glutamine amidotransferase; Provisional Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I Back     alignment and domain information
>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>KOG0370|consensus Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>KOG1224|consensus Back     alignment and domain information
>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex Back     alignment and domain information
>PRK05368 homoserine O-succinyltransferase; Provisional Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>KOG0623|consensus Back     alignment and domain information
>KOG2387|consensus Back     alignment and domain information
>KOG3179|consensus Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
1l9x_A315 Structure Of Gamma-Glutamyl Hydrolase Length = 315 7e-14
>pdb|1L9X|A Chain A, Structure Of Gamma-Glutamyl Hydrolase Length = 315 Back     alignment and structure 
Iteration: 1

 Score = 72.0 bits (175), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 66/109 (60%), Gaps = 1/109 (0%)
Query: 6   LTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDIISAR 65
           L + +N+LT +     EF+ST+E  +YP+ G+Q+HPEK  YEW       H+ + + +A 
Sbjct: 207 LKKFFNVLTTNTDGKIEFISTMEGYKYPVYGVQWHPEKAPYEWKNLDGISHAPNAVKTAF 266
Query: 66  FFSDWFIDKARLNNNSFASRDDLYKSLIQNYPNVMSYPNKLGFEQIYLF 114
           + +++F+++AR NN+ F S  +  K+LI  +  + +  N   F+Q Y+F
Sbjct: 267 YLAEFFVNEARKNNHHFKSESEEEKALIYQFSPIYT-GNISSFQQCYIF 314

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 1e-29
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 9e-06
1i1q_B192 Anthranilate synthase component II; tryptophan bio 1e-05
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex 4e-04
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 4e-04
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 5e-04
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Length = 315 Back     alignment and structure
 Score =  107 bits (268), Expect = 1e-29
 Identities = 36/109 (33%), Positives = 65/109 (59%), Gaps = 1/109 (0%)

Query: 6   LTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDIISAR 65
           L + +N+LT +     EF+ST+E  +YP+ G+Q+HPEK  YEW       H+ + + +A 
Sbjct: 207 LKKFFNVLTTNTDGKIEFISTMEGYKYPVYGVQWHPEKAPYEWKNLDGISHAPNAVKTAF 266

Query: 66  FFSDWFIDKARLNNNSFASRDDLYKSLIQNYPNVMSYPNKLGFEQIYLF 114
           + +++F+++AR NN+ F S  +  K+LI  +  + +      F+Q Y+F
Sbjct: 267 YLAEFFVNEARKNNHHFKSESEEEKALIYQFSPIYTGNIS-SFQQCYIF 314
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Length = 195 Back     alignment and structure
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Length = 192 Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Length = 201 Back     alignment and structure
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Length = 254 Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Length = 555 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 99.97
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 99.19
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 99.14
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 99.14
2w7t_A273 CTP synthetase, putative cytidine triphosphate syn 99.11
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 99.09
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 99.08
2v4u_A289 CTP synthase 2; pyrimidine biosynthesis, glutamine 99.08
2a9v_A212 GMP synthase; structural genomics, joint center fo 99.08
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 99.05
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 99.04
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 99.01
3uow_A 556 GMP synthetase; structural genomics consortium, SG 99.0
1i1q_B192 Anthranilate synthase component II; tryptophan bio 98.94
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 98.93
4gud_A211 Imidazole glycerol phosphate synthase subunit His; 98.87
3d54_D213 Phosphoribosylformylglycinamidine synthase 1; alph 98.86
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 98.82
3nva_A535 CTP synthase; rossman fold, nucleotide binding, LI 98.79
1s1m_A545 CTP synthase; CTP synthetase, UTP:ammonia ligase ( 98.75
1vco_A550 CTP synthetase; tetramer, riken structural genomic 98.7
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex 98.59
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 98.57
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 98.5
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 98.48
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 98.39
3m3p_A250 Glutamine amido transferase; structural genomics, 98.38
1q7r_A219 Predicted amidotransferase; structural genomics, Y 98.37
3l7n_A236 Putative uncharacterized protein; glutamine amidot 98.3
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 98.28
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 98.26
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 98.18
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 97.8
2vdj_A301 Homoserine O-succinyltransferase; methionine biosy 96.76
2h2w_A312 Homoserine O-succinyltransferase; TM0881, (EC 2.3. 96.62
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Back     alignment and structure
Probab=99.97  E-value=1.8e-31  Score=209.25  Aligned_cols=109  Identities=34%  Similarity=0.696  Sum_probs=101.0

Q ss_pred             CCCCCcEEEEEecCCCCeeEEEEEeCCCcEEEEeecCCCCccccccCCCCCCCHhHHHHHHHHHHHHHHHHHhCCCCCCC
Q psy12876          5 GLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDIISARFFSDWFIDKARLNNNSFAS   84 (115)
Q Consensus         5 ~L~~~f~v~a~s~d~~~~fv~aie~~~~pi~gvQfHPE~~~~e~~~~~~~~hs~~~~~~~q~l~~fFv~~ar~~~~~f~~   84 (115)
                      .||++++++|++.|+..++|+++++++.|++|||||||+..++|+....++||.++++.++.|++.|+++||++.|+|+|
T Consensus       206 ~l~~g~~v~A~s~dg~ve~i~~i~~~~~~i~GVQfHPE~~~~e~~~~~~~p~s~~a~~~~~~lf~~Fv~~a~~~~~~f~~  285 (315)
T 1l9x_A          206 KLKKFFNVLTTNTDGKIEFISTMEGYKYPVYGVQWHPEKAPYEWKNLDGISHAPNAVKTAFYLAEFFVNEARKNNHHFKS  285 (315)
T ss_dssp             HHHHHEEEEEEEESSSCEEEEEEEESSSCEEEESSCTTHHHHCCSSCTTCCCCHHHHHHHHHHHHHHHHHHTTSCCCCSS
T ss_pred             ccCCCCEEEEEcCCCCEEEEEEeccCCCCEEEEEeCCCCCcccccccccCCccHHHHHHHHHHHHHHHHHHHhccCCCCC
Confidence            57789999999998888888999999889999999999999999875567999999999999999999999999999999


Q ss_pred             HHHHHhhccccccccccCCCCC-ceeEEEecC
Q psy12876         85 RDDLYKSLIQNYPNVMSYPNKL-GFEQIYLFK  115 (115)
Q Consensus        85 ~~~~~~~li~n~~~~~~~~~~~-~~~q~Y~f~  115 (115)
                      .++|.++|||||+|+  |||.. +|+|||||+
T Consensus       286 ~~~~~~~liyn~~p~--~~~~~~~~~q~y~f~  315 (315)
T 1l9x_A          286 ESEEEKALIYQFSPI--YTGNISSFQQCYIFD  315 (315)
T ss_dssp             HHHHHHHSGGGCCCE--ECTTTSSCSEEEEEC
T ss_pred             HHHHHHhhhccCCCE--ecCCCCCeeEEEeeC
Confidence            999999999999999  99965 899999996
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Back     alignment and structure
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Back     alignment and structure
>2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Back     alignment and structure
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} Back     alignment and structure
>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* Back     alignment and structure
>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A Back     alignment and structure
>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 115
d1l9xa_288 c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Ho 4e-26
d1jvna2232 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain 5e-04
d1a9xb2228 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthe 0.004
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: gamma-glutamyl hydrolase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 96.5 bits (239), Expect = 4e-26
 Identities = 37/109 (33%), Positives = 66/109 (60%), Gaps = 1/109 (0%)

Query: 6   LTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDIISAR 65
           L + +N+LT +     EF+ST+E  +YP+ G+Q+HPEK  YEW       H+ + + +A 
Sbjct: 180 LKKFFNVLTTNTDGKIEFISTMEGYKYPVYGVQWHPEKAPYEWKNLDGISHAPNAVKTAF 239

Query: 66  FFSDWFIDKARLNNNSFASRDDLYKSLIQNYPNVMSYPNKLGFEQIYLF 114
           + +++F+++AR NN+ F S  +  K+LI  +  + +  N   F+Q Y+F
Sbjct: 240 YLAEFFVNEARKNNHHFKSESEEEKALIYQFSPIYT-GNISSFQQCYIF 287
>d1jvna2 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Length = 232 Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Length = 228 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
d1l9xa_288 gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta 100.0
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 99.3
d1wl8a1188 GMP synthase subunit A, GuaAA {Archaeon Pyrococcus 99.21
d1a9xb2228 Carbamoyl phosphate synthetase, small subunit C-te 99.2
d1i7qb_192 Anthranilate synthase GAT subunit, TrpG {Serratia 99.18
d1qdlb_195 Anthranilate synthase GAT subunit, TrpG {Archaeon 99.12
d1gpma2205 GMP synthetase {Escherichia coli [TaxId: 562]} 99.09
d1jvna2232 GAT subunit, HisH, (or domain) of imidazoleglycero 98.58
d1ka9h_195 GAT subunit, HisH, (or domain) of imidazoleglycero 98.57
d1k9vf_200 GAT subunit, HisH, (or domain) of imidazoleglycero 98.47
d1s1ma1258 CTP synthase PyrG, C-terminal domain {Escherichia 98.47
d2abwa1218 Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p 98.41
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 98.37
d1vcoa1250 CTP synthase PyrG, C-terminal domain {Thermus ther 98.32
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 98.25
d1o1ya_230 Hypothetical protein TM1158 {Thermotoga maritima [ 97.88
d2ghra1281 Homoserine O-succinyltransferase HTS (MetA) {Bacil 95.37
d1t3ta2262 FGAM synthase PurL, amidotransferase domain {Salmo 82.9
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: gamma-glutamyl hydrolase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.5e-37  Score=235.54  Aligned_cols=109  Identities=34%  Similarity=0.696  Sum_probs=104.2

Q ss_pred             CCCCCcEEEEEecCCCCeeEEEEEeCCCcEEEEeecCCCCccccccCCCCCCCHhHHHHHHHHHHHHHHHHHhCCCCCCC
Q psy12876          5 GLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHSHDDIISARFFSDWFIDKARLNNNSFAS   84 (115)
Q Consensus         5 ~L~~~f~v~a~s~d~~~~fv~aie~~~~pi~gvQfHPE~~~~e~~~~~~~~hs~~~~~~~q~l~~fFv~~ar~~~~~f~~   84 (115)
                      .|+++|+++|++.|+..++|++++++++|++|||||||++++||.+...++||.++++++|+++|||+++||+|+|+|.+
T Consensus       179 ~l~~~~~v~a~s~d~~~e~I~~ie~~~~pi~GvQfHPEk~~fE~~~~~~~~H~~~~~~~~~~~~~ffv~~~rkn~~~f~~  258 (288)
T d1l9xa_         179 KLKKFFNVLTTNTDGKIEFISTMEGYKYPVYGVQWHPEKAPYEWKNLDGISHAPNAVKTAFYLAEFFVNEARKNNHHFKS  258 (288)
T ss_dssp             HHHHHEEEEEEEESSSCEEEEEEEESSSCEEEESSCTTHHHHCCSSCTTCCCCHHHHHHHHHHHHHHHHHHTTSCCCCSS
T ss_pred             hcCCceEEEEEECCCCeEEEEEEEcCCCcEEEEEcCCCCCCcccccCCCCCCCHHHHHHHHHHHHHHHHHHHhccCCCCC
Confidence            56788999999999888999999999999999999999999999988889999999999999999999999999999999


Q ss_pred             HHHHHhhccccccccccCCCCC-ceeEEEecC
Q psy12876         85 RDDLYKSLIQNYPNVMSYPNKL-GFEQIYLFK  115 (115)
Q Consensus        85 ~~~~~~~li~n~~~~~~~~~~~-~~~q~Y~f~  115 (115)
                      .+++.+.|||||+|+  |+|+. +|+|||||+
T Consensus       259 ~~~~~~~lI~ny~pv--~~~~~~~~~q~Y~f~  288 (288)
T d1l9xa_         259 ESEEEKALIYQFSPI--YTGNISSFQQCYIFD  288 (288)
T ss_dssp             HHHHHHHSGGGCCCE--ECTTTSSCSEEEEEC
T ss_pred             HHHHHHHhhcCCCcE--EecCCCceEEEEeeC
Confidence            999999999999999  99876 899999996
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1wl8a1 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure