Diaphorina citri psyllid: psy12894

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
MIISSSHFLSDSSDVIVDFNVDDLTTINSSMNHCNCACGQVERNQRIVGGNVTKLHEFPWIAALTKKGKFYCGATLIAKRHVLTAAHCIEGVNPKEIKVTLGEHDRLSKNESVPVIIHFSVSNT
cEEcccCEECccccCECcccccccccccccccccccccccccccccCEccccccccccccEEEEEEccEEEEEEEEEcccEEEEccccccccccccEEEEEccCEccccccccCEEEccccccc
*I***SHFLSDSSDVIVDFNVDDLTTINSSMNHCNCACGQVERNQRIVGGNVTKLHEFPWIAALTKKGKFYCGATLIAKRHVLTAAHCIEGVNPKEIKVTLGEHDRLSKNESVPVIIHF*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIISSSHFLSDSSDVIVDFNVDDLTTINSSMNHCNCACGQVERNQRIVGGNVTKLHEFPWIAALTKKGKFYCGATLIAKRHVLTAAHCIEGVNPKEIKVTLGEHDRLSKNESVPVIIHFSVSNT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004252 [MF]serine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008236
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0044469 [BP]envenomation resulting in positive regulation of blood coagulation in other organismprobableGO:0044468, GO:0044483, GO:0050896, GO:0007610, GO:0008150, GO:0035737, GO:0035738, GO:0051705, GO:0051704
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0035807 [BP]positive regulation of blood coagulation in other organismprobableGO:0032101, GO:0035806, GO:0051240, GO:0048583, GO:1900046, GO:0050789, GO:0008150, GO:0050820, GO:0061041, GO:0065007, GO:0050818, GO:0051239, GO:0048518, GO:0030193, GO:0080134, GO:0051704, GO:0065008, GO:1900048, GO:0035821, GO:0030194
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0030195 [BP]negative regulation of blood coagulationprobableGO:0032101, GO:0080134, GO:0051241, GO:0048583, GO:1900046, GO:0050789, GO:0008150, GO:0061041, GO:1900047, GO:0065007, GO:0051239, GO:0030193, GO:0048519, GO:0050818, GO:0050819
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1MD8, chain A
Confidence level:very confident
Coverage over the Query: 30-122
View the alignment between query and template
View the model in PyMOL