Psyllid ID: psy12894


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
MIISSSHFLSDSSDVIVDFNVDDLTTINSSMNHCNCACGQVERNQRIVGGNVTKLHEFPWIAALTKKGKFYCGATLIAKRHVLTAAHCIEGVNPKEIKVTLGEHDRLSKNESVPVIIHFSVSNT
cEEcccEEEEccccEEEcccccccccccccccccccccccccccccEEccccccccccccEEEEEEccEEEEEEEEEcccEEEEccccccccccccEEEEEccEEccccccccEEEEccccccc
cEEEEccccccccccccccccccccccccccccccccccccccccccEccEEccccccccEEEEEccccEEEEEEEccccEEEEcHHHcccccHHHcEEEEcccEcccccccccEEEEEEEEcc
miissshflsdssdvivdfnvddlttinssmnhcncacgqvernqrivggnvtklhefpwIAALTKKGKFYCGATLIAKRHVLTAAHciegvnpkeIKVTlgehdrlsknesvpVIIHFSVSNT
miissshflsdssdVIVDFNVDDLTTINSSMNHCNCACGQVERNQRIVGGNVTKLHEFPWIAALTKKGKFYCGATLIAKRHVLTAAHCIEGVNPKEIKVTLgehdrlsknesvpviihfsvsnt
MIIssshflsdssDVIVDFNVDDLTTINSSMNHCNCACGQVERNQRIVGGNVTKLHEFPWIAALTKKGKFYCGATLIAKRHVLTAAHCIEGVNPKEIKVTLGEHDRLSKNESVPVIIHFSVSNT
*************DVIVDFNVDDLTTINSSMNHCNCACGQVERNQRIVGGNVTKLHEFPWIAALTKKGKFYCGATLIAKRHVLTAAHCIEGVNPKEIKVTLGEHD******SVPVIIHF*****
*I***SHFLSDSSDVIVDFNV****************CGQVERNQRIVGGNVTKLHEFPWIAALTKKGKFYCGATLIAKRHVLTAAHCIEGVNPKEIKVTLGEHDRLSKNESV*****F*****
********LSDSSDVIVDFNVDDLTTINSSMNHCNCACGQVERNQRIVGGNVTKLHEFPWIAALTKKGKFYCGATLIAKRHVLTAAHCIEGVNPKEIKVTLGEHDRLSKNESVPVIIHFSVSNT
MIISSSHFLSDSSDVIVDFNVDDLTTINSSMNHCNCACGQVERNQRIVGGNVTKLHEFPWIAALTKKGKFYCGATLIAKRHVLTAAHCIEGVNPKEIKVTLGEHDRLSKNESVPVIIHFSVS**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIISSSHFLSDSSDVIVDFNVDDLTTINSSMNHCNCACGQVERNQRIVGGNVTKLHEFPWIAALTKKGKFYCGATLIAKRHVLTAAHCIEGVNPKEIKVTLGEHDRLSKNESVPVIIHFSVSNT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query124 2.2.26 [Sep-21-2011]
Q8MQS8 405 Venom serine protease 34 no N/A 0.669 0.204 0.453 2e-13
Q3UP87 265 Neutrophil elastase OS=Mu yes N/A 0.516 0.241 0.461 1e-12
Q14C59 416 Transmembrane protease se no N/A 0.548 0.163 0.465 2e-11
Q9DBI0 811 Transmembrane protease se no N/A 0.685 0.104 0.406 4e-11
P79953 1004 Ovochymase-2 OS=Xenopus l N/A N/A 0.540 0.066 0.455 7e-11
P06868 812 Plasminogen OS=Bos taurus no N/A 0.766 0.116 0.372 1e-10
P98074 1034 Enteropeptidase OS=Sus sc no N/A 0.677 0.081 0.377 2e-10
Q66TN7 980 Ovochymase-2 OS=Rhinella N/A N/A 0.483 0.061 0.459 6e-10
P80009 333 Plasminogen (Fragment) OS no N/A 0.637 0.237 0.428 7e-10
Q8NF86 280 Serine protease 33 OS=Hom yes N/A 0.548 0.242 0.449 1e-09
>sp|Q8MQS8|SP34_APIME Venom serine protease 34 OS=Apis mellifera PE=2 SV=1 Back     alignment and function desciption
 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (63%), Gaps = 3/86 (3%)

Query: 35  NCACGQVERNQRIVGGNVTKLHEFPWIAAL--TKKGKFYCGATLIAKRHVLTAAHCIEGV 92
           NC CG  +   RIVGG  T ++EFP +A +  T +    CGAT+I+KR+VLTAAHCI   
Sbjct: 150 NCNCGW-KNPSRIVGGTNTGINEFPMMAGIKRTYEPGMICGATIISKRYVLTAAHCIIDE 208

Query: 93  NPKEIKVTLGEHDRLSKNESVPVIIH 118
           N  ++ + +GEHD  SK E+   ++H
Sbjct: 209 NTTKLAIVVGEHDWSSKTETNATVLH 234





Apis mellifera (taxid: 7460)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: -
>sp|Q3UP87|ELNE_MOUSE Neutrophil elastase OS=Mus musculus GN=Elane PE=2 SV=1 Back     alignment and function description
>sp|Q14C59|TM11L_MOUSE Transmembrane protease serine 11B-like protein OS=Mus musculus GN=Tmprss11bnl PE=2 SV=2 Back     alignment and function description
>sp|Q9DBI0|TMPS6_MOUSE Transmembrane protease serine 6 OS=Mus musculus GN=Tmprss6 PE=1 SV=4 Back     alignment and function description
>sp|P79953|OVCH2_XENLA Ovochymase-2 OS=Xenopus laevis GN=ovch2 PE=1 SV=1 Back     alignment and function description
>sp|P06868|PLMN_BOVIN Plasminogen OS=Bos taurus GN=PLG PE=1 SV=2 Back     alignment and function description
>sp|P98074|ENTK_PIG Enteropeptidase OS=Sus scrofa GN=TMPRSS15 PE=1 SV=1 Back     alignment and function description
>sp|Q66TN7|OVCH2_RHIAE Ovochymase-2 OS=Rhinella arenarum GN=OVCH2 PE=2 SV=2 Back     alignment and function description
>sp|P80009|PLMN_CANFA Plasminogen (Fragment) OS=Canis familiaris GN=PLG PE=1 SV=1 Back     alignment and function description
>sp|Q8NF86|PRS33_HUMAN Serine protease 33 OS=Homo sapiens GN=PRSS33 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query124
242019714 315 trypsin, putative [Pediculus humanus cor 0.782 0.307 0.557 6e-26
189234557 286 PREDICTED: similar to oviductin [Triboli 0.685 0.297 0.541 9e-22
357619638 642 serine protease-like protein [Danaus ple 0.677 0.130 0.558 6e-20
347972160 327 AGAP004566-PA [Anopheles gambiae str. PE 0.653 0.247 0.518 6e-19
195129139 377 GI13812 [Drosophila mojavensis] gi|19392 0.75 0.246 0.473 1e-18
307208933223 Serine protease 27 [Harpegnathos saltato 0.588 0.327 0.540 1e-18
328777198 302 PREDICTED: trypsin-7-like [Apis mellifer 0.612 0.251 0.552 3e-18
350401720 302 PREDICTED: trypsin-7-like [Bombus impati 0.612 0.251 0.552 3e-18
340718310 302 PREDICTED: trypsin-7-like [Bombus terres 0.612 0.251 0.552 3e-18
380027809 302 PREDICTED: trypsin-7-like [Apis florea] 0.612 0.251 0.552 3e-18
>gi|242019714|ref|XP_002430304.1| trypsin, putative [Pediculus humanus corporis] gi|212515419|gb|EEB17566.1| trypsin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 58/104 (55%), Positives = 73/104 (70%), Gaps = 7/104 (6%)

Query: 17  VDF--NVDDLTTIN---SSMNHCNCACGQVERNQRIVGGNVTKLHEFPWIAALTKKGKFY 71
           +DF  N    + IN     + HC C CG   R  RIVGGNVTK+ E+PWIAA+ +KGKFY
Sbjct: 38  IDFVNNTTSTSIINKPVGDLPHCGCYCGTGGRKHRIVGGNVTKISEYPWIAAMFRKGKFY 97

Query: 72  CGATLIAKRHVLTAAHCIEGVNPKEIKVTLGEHDR--LSKNESV 113
           CG  LI +RHVLTAAHCI G NP+++KV LGEHDR  L++ ++V
Sbjct: 98  CGGALITRRHVLTAAHCIYGFNPQDLKVVLGEHDRDVLTETDTV 141




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189234557|ref|XP_974113.2| PREDICTED: similar to oviductin [Tribolium castaneum] gi|270002766|gb|EEZ99213.1| serine protease P11 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357619638|gb|EHJ72128.1| serine protease-like protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|347972160|ref|XP_313869.5| AGAP004566-PA [Anopheles gambiae str. PEST] gi|333469199|gb|EAA09293.5| AGAP004566-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195129139|ref|XP_002009016.1| GI13812 [Drosophila mojavensis] gi|193920625|gb|EDW19492.1| GI13812 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|307208933|gb|EFN86144.1| Serine protease 27 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328777198|ref|XP_003249299.1| PREDICTED: trypsin-7-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350401720|ref|XP_003486239.1| PREDICTED: trypsin-7-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340718310|ref|XP_003397612.1| PREDICTED: trypsin-7-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380027809|ref|XP_003697609.1| PREDICTED: trypsin-7-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query124
FB|FBgn0036436 374 CG4914 [Drosophila melanogaste 0.677 0.224 0.5 2.2e-18
FB|FBgn0039272 325 CG11836 [Drosophila melanogast 0.701 0.267 0.425 9.5e-18
FB|FBgn0034661 372 CG4386 [Drosophila melanogaste 0.653 0.217 0.444 3.9e-16
FB|FBgn0034666 352 CG9294 [Drosophila melanogaste 0.645 0.227 0.412 4.2e-15
FB|FBgn0042098 364 CG18735 [Drosophila melanogast 0.572 0.195 0.478 4.8e-15
UNIPROTKB|A6QPP7 267 ELA2 "ELA2 protein" [Bos tauru 0.516 0.239 0.476 1e-12
UNIPROTKB|G3MWP1 286 ELANE "Uncharacterized protein 0.516 0.223 0.476 1.5e-12
MGI|MGI:2679229 265 Elane "elastase, neutrophil ex 0.516 0.241 0.461 1.7e-12
UNIPROTKB|I3LK80 267 ELANE "Uncharacterized protein 0.524 0.243 0.454 2.3e-12
FB|FBgn0036427 411 CG4613 [Drosophila melanogaste 0.758 0.228 0.395 3e-12
FB|FBgn0036436 CG4914 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 225 (84.3 bits), Expect = 2.2e-18, P = 2.2e-18
 Identities = 42/84 (50%), Positives = 54/84 (64%)

Query:    28 NSSMNHCNCACGQVERNQRIVGGNVTKLHEFPWIAALTKKGKFYCGATLIAKRHVLTAAH 87
             N +   C+C CG+     RIVGG  T + E+PW+A L+   +FYCG TLI  R+VLTAAH
Sbjct:   109 NQTSPTCSCRCGERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAH 168

Query:    88 CIEGVNPKEIKVTLGEHDRLSKNE 111
             C++G     IKVT GEHDR +  E
Sbjct:   169 CVKGFMWFMIKVTFGEHDRCNDKE 192




GO:0004252 "serine-type endopeptidase activity" evidence=ISS;NAS
GO:0006508 "proteolysis" evidence=IEA;NAS
FB|FBgn0039272 CG11836 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0034661 CG4386 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0034666 CG9294 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0042098 CG18735 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|A6QPP7 ELA2 "ELA2 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3MWP1 ELANE "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2679229 Elane "elastase, neutrophil expressed" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|I3LK80 ELANE "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0036427 CG4613 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
smart00020 229 smart00020, Tryp_SPc, Trypsin-like serine protease 7e-26
cd00190 232 cd00190, Tryp_SPc, Trypsin-like serine protease; M 4e-24
pfam00089 218 pfam00089, Trypsin, Trypsin 9e-15
COG5640 413 COG5640, COG5640, Secreted trypsin-like serine pro 9e-09
COG3591 251 COG3591, COG3591, V8-like Glu-specific endopeptida 0.002
>gnl|CDD|214473 smart00020, Tryp_SPc, Trypsin-like serine protease Back     alignment and domain information
 Score = 96.2 bits (240), Expect = 7e-26
 Identities = 36/79 (45%), Positives = 46/79 (58%), Gaps = 6/79 (7%)

Query: 46  RIVGGNVTKLHEFPWIAALT-KKGKFYCGATLIAKRHVLTAAHCIEGVNPKEIKVTLGEH 104
           RIVGG+   +  FPW  +L    G+ +CG +LI+ R VLTAAHC+ G +P  I+V LG H
Sbjct: 1   RIVGGSEANIGSFPWQVSLQYGGGRHFCGGSLISPRWVLTAAHCVRGSDPSNIRVRLGSH 60

Query: 105 DRLSKNESV-----PVIIH 118
           D  S  E        VIIH
Sbjct: 61  DLSSGEEGQVIKVSKVIIH 79


Many of these are synthesised as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. A few, however, are active as single chain molecules, and others are inactive due to substitutions of the catalytic triad residues. Length = 229

>gnl|CDD|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information
>gnl|CDD|227927 COG5640, COG5640, Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|226119 COG3591, COG3591, V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 124
cd00190 232 Tryp_SPc Trypsin-like serine protease; Many of the 99.75
smart00020 229 Tryp_SPc Trypsin-like serine protease. Many of the 99.72
PF00089 220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 99.66
KOG3627|consensus 256 99.58
COG5640 413 Secreted trypsin-like serine protease [Posttransla 99.24
PF09342 267 DUF1986: Domain of unknown function (DUF1986); Int 98.55
PF03761 282 DUF316: Domain of unknown function (DUF316) ; Inte 98.4
COG3591 251 V8-like Glu-specific endopeptidase [Amino acid tra 96.21
PF13365120 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 95.71
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
Probab=99.75  E-value=7.6e-18  Score=116.45  Aligned_cols=77  Identities=42%  Similarity=0.761  Sum_probs=65.0

Q ss_pred             eeCCEEcCCCCCceEEEEEeC-CceeEEEEEecCCEEEecccccCCCCCceEEEEEceeecCCC---C---CeecEEECC
Q psy12894         47 IVGGNVTKLHEFPWIAALTKK-GKFYCGATLIAKRHVLTAAHCIEGVNPKEIKVTLGEHDRLSK---N---ESVPVIIHF  119 (124)
Q Consensus        47 i~gg~~~~~~~~Pw~v~l~~~-~~~~CgGsLi~~~~vlTaahC~~~~~~~~~~V~~G~~~~~~~---~---~~~~vi~Hp  119 (124)
                      |+||..+..++|||+|.+... ..+.|+|+||+++||||||||+.......+.|++|..+....   .   ...++++||
T Consensus         1 i~~G~~~~~~~~Pw~v~i~~~~~~~~C~GtlIs~~~VLTaAhC~~~~~~~~~~v~~g~~~~~~~~~~~~~~~v~~~~~hp   80 (232)
T cd00190           1 IVGGSEAKIGSFPWQVSLQYTGGRHFCGGSLISPRWVLTAAHCVYSSAPSNYTVRLGSHDLSSNEGGGQVIKVKKVIVHP   80 (232)
T ss_pred             CcCCeECCCCCCCCEEEEEccCCcEEEEEEEeeCCEEEECHHhcCCCCCccEEEEeCcccccCCCCceEEEEEEEEEECC
Confidence            579999999999999999876 678999999999999999999986556789999998876542   1   134599999


Q ss_pred             CCCC
Q psy12894        120 SVSN  123 (124)
Q Consensus       120 ~y~~  123 (124)
                      +|+.
T Consensus        81 ~y~~   84 (232)
T cd00190          81 NYNP   84 (232)
T ss_pred             CCCC
Confidence            9974



Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues.

>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3627|consensus Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
1qrz_A 246 Catalytic Domain Of Plasminogen Length = 246 2e-10
4dur_A 791 The X-Ray Crystal Structure Of Full-Length Type Ii 3e-10
1bui_B 250 Structure Of The Ternary Microplasmin-Staphylokinas 3e-10
1bml_A 250 Complex Of The Catalytic Domain Of Human Plasmin An 3e-10
1l4z_A 248 X-Ray Crystal Structure Of The Complex Of Microplas 3e-10
1l4d_A 249 Crystal Structure Of Microplasminogen-streptokinase 4e-10
3uir_A 247 Crystal Structure Of The Plasmin-Textilinin-1 Compl 4e-10
1ddj_A 247 Crystal Structure Of Human Plasminogen Catalytic Do 4e-10
2xxl_A 408 Crystal Structure Of Drosophila Grass Clip Serine P 4e-10
1fy3_A 225 [g175q]hbp, A Mutant Of Human Heparin Binding Prote 1e-09
1a7s_A 225 Atomic Resolution Structure Of Hbp Length = 225 1e-09
1rjx_B 247 Human Plasminogen Catalytic Domain, K698m Mutant Le 2e-09
1ym0_A 238 Crystal Structure Of Earthworm Fibrinolytic Enzyme 6e-09
1fuj_A 221 Pr3 (Myeloblastin) Length = 221 8e-09
1fy1_A 225 [r23s,F25e]hbp, A Mutant Of Human Heparin Binding P 1e-08
1fdp_A 235 Proenzyme Of Human Complement Factor D, Recombinant 2e-08
1ppg_E 218 The Refined 2.3 Angstroms Crystal Structure Of Huma 5e-08
1hne_E 218 Structure Of Human Neutrophil Elastase In Complex W 5e-08
2rg3_A 218 Covalent Complex Structure Of Elastase Length = 218 5e-08
4d9q_A 228 Inhibiting Alternative Pathway Complement Activatio 6e-08
1ppf_E 218 X-Ray Crystal Structure Of The Complex Of Human Leu 6e-08
2xwa_A 228 Crystal Structure Of Complement Factor D Mutant R20 7e-08
4dgj_A 235 Structure Of A Human Enteropeptidase Light Chain Va 8e-08
1gdu_A 224 Fusarium Oxysporum Trypsin At Atomic Resolution Len 8e-08
1dsu_A 228 Human Factor D, Complement Activating Enzyme Length 8e-08
1ppz_A 224 Trypsin Complexes At Atomic And Ultra-High Resoluti 8e-08
2xw9_A 228 Crystal Structure Of Complement Factor D Mutant S18 8e-08
1dst_A 228 Mutant Of Factor D With Enhanced Catalytic Activity 9e-08
1ekb_B 235 The Serine Protease Domain Of Enteropeptidase Bound 9e-08
1b0f_A 218 Crystal Structure Of Human Neutrophil Elastase With 1e-07
3h7t_A 235 Crystal Structure Of Scabies Mite Inactivated Prote 2e-07
1spj_A 238 Structure Of Mature Human Tissue Kallikrein (Human 2e-07
1xvm_A 224 Trypsin From Fusarium Oxysporum- Room Temperature T 3e-07
1elt_A 236 Structure Of Native Pancreatic Elastase From North 3e-07
1gvz_A 237 Prostate Specific Antigen (Psa) From Stallion Semin 4e-07
2b9l_A 394 Crystal Structure Of Prophenoloxidase Activating Fa 9e-07
2bq6_B 249 Crystal Structure Of Factor Xa In Complex With 21 L 1e-06
2olg_A 278 Crystal Structure Of The Serine Protease Domain Of 1e-06
1pyt_D 251 Ternary Complex Of Procarboxypeptidase A, Proprotei 2e-06
3gyl_B 261 Structure Of Prostasin At 1.3 Angstroms Resolution 2e-06
3e0p_B 271 The X-Ray Structure Of Human Prostasin In Complex W 2e-06
2wph_S 235 Factor Ixa Superactive Triple Mutant Length = 235 2e-06
2wpi_S 235 Factor Ixa Superactive Double Mutant Length = 235 2e-06
1pfx_C 235 Porcine Factor Ixa Length = 235 2e-06
1ybw_A 283 Protease Domain Of Hgfa With No Inhibitor Length = 2e-06
2wpm_S 235 Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Le 2e-06
1rfn_A 235 Human Coagulation Factor Ixa In Complex With P-Amin 2e-06
3t2n_A 372 Human Hepsin Protease In Complex With The Fab Fragm 2e-06
3dfj_A 263 Crystal Structure Of Human Prostasin Length = 263 2e-06
3kcg_H 235 Crystal Structure Of The Antithrombin-Factor Ixa- P 2e-06
1z8g_A 372 Crystal Structure Of The Extracellular Region Of Th 2e-06
1bru_P 241 Structure Of Porcine Pancreatic Elastase Complexed 2e-06
3f6u_H 240 Crystal Structure Of Human Activated Protein C (Apc 3e-06
1aut_C 250 Human Activated Protein C Length = 250 3e-06
1npm_A 225 Neuropsin, A Serine Protease Expressed In The Limbi 5e-06
1eq9_A 222 Crystal Structure Of Fire Ant Chymotrypsin Complexe 5e-06
1dan_H 254 Complex Of Active Site Inhibited Human Blood Coagul 5e-06
2f83_A 625 Crystal Structure At 2.9 Angstroms Resolution Of Hu 7e-06
1azz_A 226 Fiddler Crab Collagenase Complexed To Ecotin Length 7e-06
1xka_C 235 Factor Xa Complexed With A Synthetic Inhibitor Fx-2 7e-06
2y5f_A 234 Factor Xa - Cation Inhibitor Complex Length = 234 7e-06
1mq5_A 233 Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-ch 7e-06
1fjs_A 234 Crystal Structure Of The Inhibitor Zk-807834 (Ci-10 7e-06
2bok_A 241 Factor Xa- Cation Length = 241 8e-06
3ens_B 238 Crystal Structure Of Human Fxa In Complex With Meth 8e-06
1mza_A 240 Crystal Structure Of Human Pro-Granzyme K Length = 8e-06
1hcg_A 241 Structure Of Human Des(1-45) Factor Xa At 2.2 Angst 9e-06
2gd4_H 241 Crystal Structure Of The Antithrombin-S195a Factor 9e-06
4igd_A 406 Crystal Structure Of The Zymogen Catalytic Region O 1e-05
2oq5_A 232 Crystal Structure Of Desc1, A New Member Of The Typ 1e-05
3rp2_A 224 The Structure Of Rat Mast Cell Protease Ii At 1.9-A 1e-05
1ezq_A 254 Crystal Structure Of Human Coagulation Factor Xa Co 1e-05
1c5m_D 255 Structural Basis For Selectivity Of A Small Molecul 1e-05
2cga_A 245 Bovine Chymotrypsinogen A. X-Ray Crystal Structure 1e-05
1a5i_A 265 Catalytic Domain Of Vampire Bat (Desmodus Rotundus) 1e-05
1o5e_H 255 Dissecting And Designing Inhibitor Selectivity Dete 1e-05
1a0l_A 244 Human Beta-Tryptase: A Ring-Like Tetramer With Acti 1e-05
2zeb_A 243 Potent, Nonpeptide Inhibitors Of Human Mast Cell Tr 1e-05
4h4f_A 249 Crystal Structure Of Human Chymotrypsin C (ctrc) Bo 1e-05
2bm2_A 245 Human Beta-Ii Tryptase In Complex With 4-(3-Aminome 1e-05
4an7_A 231 Kunitz Type Trypsin Inhibitor Complex With Porcine 1e-05
1fxy_A 228 Coagulation Factor Xa-Trypsin Chimera Inhibited Wit 1e-05
3fzz_A 227 Structure Of Grc Length = 227 1e-05
3g01_A 227 Structure Of Grc Mutant E192rE193G Length = 227 1e-05
1kdq_A131 Crystal Structure Analysis Of The Mutant S189d Rat 1e-05
3nxp_A 424 Crystal Structure Of Human Prethrombin-1 Length = 4 1e-05
2f9n_A 245 Crystal Structure Of The Recombinant Human Alpha I 2e-05
2f9o_A 245 Crystal Structure Of The Recombinant Human Alpha I 2e-05
1lto_A 245 Human Alpha1-Tryptase Length = 245 2e-05
3gov_B 251 Crystal Structure Of The Catalytic Region Of Human 2e-05
1euf_A 227 Bovine Duodenase(New Serine Protease), Crystal Stru 2e-05
2zgc_A 240 Crystal Structure Of Active Human Granzyme M Length 2e-05
2zgj_A 240 Crystal Structure Of D86n-gzmm Complexed With Its O 2e-05
2any_A 241 Expression, Crystallization And The Three-Dimension 2e-05
1md8_A 329 Monomeric Structure Of The Active Catalytic Domain 2e-05
1md7_A 328 Monomeric Structure Of The Zymogen Of Complement Pr 2e-05
3tgj_E 233 S195a Trypsinogen Complexed With Bovine Pancreatic 3e-05
2anw_A 241 Expression, Crystallization And Three-Dimensional S 3e-05
1fax_A 254 Coagulation Factor Xa Inhibitor Complex Length = 25 3e-05
1co7_E 245 R117h Mutant Rat Anionic Trypsin Complexed With Bov 3e-05
1pyt_C 253 Ternary Complex Of Procarboxypeptidase A, Proprotei 3e-05
2psx_A 227 Crystal Structure Of Human Kallikrein 5 In Complex 3e-05
2jet_B128 Crystal Structure Of A Trypsin-Like Mutant (S189d, 3e-05
3ela_H 254 Crystal Structure Of Active Site Inhibited Coagulat 3e-05
2f91_A 237 1.2a Resolution Structure Of A Crayfish Trypsin Com 3e-05
1au8_A 224 Human Cathepsin G Length = 224 3e-05
1kyn_B 235 Cathepsin-G Length = 235 4e-05
3tju_A 226 Crystal Structure Of Human Granzyme H With An Inhib 4e-05
4gaw_A 226 Crystal Structure Of Active Human Granzyme H Length 4e-05
1zjd_A 237 Crystal Structure Of The Catalytic Domain Of Coagul 4e-05
1mh0_A 287 Crystal Structure Of The Anticoagulant Slow Form Of 4e-05
2bdy_A 289 Thrombin In Complex With Inhibitor Length = 289 4e-05
1zlr_A 237 Factor Xi Catalytic Domain Complexed With 2-Guanidi 4e-05
1xx9_A 238 Crystal Structure Of The Fxia Catalytic Domain In C 4e-05
1zpz_A 238 Factor Xi Catalytic Domain Complexed With N-((R)-1- 4e-05
1zhm_A 238 Crystal Structure Of The Catalytic Domain Of The Co 4e-05
1zhp_A 238 Crystal Structure Of The Catalytic Domain Of Coagul 4e-05
1d9i_A 288 Structure Of Thrombin Complexed With Selective Non- 4e-05
3sor_A 238 Factor Xia In Complex With A Clorophenyl-tetrazole 4e-05
3bg8_A 238 Crystal Structure Of Factor Xia In Complex With Cla 4e-05
1klt_A 226 Crystal Structure Of Pmsf-Treated Human Chymase At 4e-05
1eoj_A 289 Design Of P1' And P3' Residues Of Trivalent Thrombi 4e-05
1zhr_A 238 Crystal Structure Of The Catalytic Domain Of Coagul 4e-05
1jwt_A 305 Crystal Structure Of Thrombin In Complex With A Nov 4e-05
3sqe_E 290 Crystal Structure Of Prethrombin-2 Mutant S195a In 4e-05
1elv_A 333 Crystal Structure Of The Catalytic Domain Of Human 4e-05
1mct_A 223 The Refined 1.6 Angstroms Resolution Crystal Struct 5e-05
1d6w_A 287 Structure Of Thrombin Complexed With Selective Non- 5e-05
1xxd_A 238 Crystal Structure Of The Fxia Catalytic Domain In C 5e-05
1nm6_A 287 Thrombin In Complex With Selective Macrocyclic Inhi 5e-05
1nu9_A 291 Staphylocoagulase-prethrombin-2 Complex Length = 29 5e-05
1dm4_B 260 Ser195ala Mutant Of Human Thrombin Complexed With F 5e-05
1hag_E 295 The Isomorphous Structures Of Prethrombin2, Hirugen 5e-05
3k65_B 308 Crystal Structure Of Prethombin-2FRAGMENT-2 Complex 5e-05
1tfx_A 223 Complex Of The Second Kunitz Domain Of Tissue Facto 5e-05
1an1_E 223 Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Len 5e-05
1sc8_U 262 Urokinase Plasminogen Activator B-Chain-J435 Comple 5e-05
1mtn_B131 Bovine Alpha-Chymotrypsin:bpti Crystallization Leng 5e-05
1op0_A 234 Crystal Structure Of Aav-sp-i, A Glycosylated Snake 5e-05
2xrc_A 565 Human Complement Factor I Length = 565 5e-05
1aks_A125 Crystal Structure Of The First Active Autolysate Fo 6e-05
3myw_A 223 The Bowman-Birk Type Inhibitor From Mung Bean In Te 6e-05
1f7z_A 233 Rat Trypsinogen K15a Complexed With Bovine Pancreat 6e-05
1dlk_B 230 Crystal Structure Analysis Of Delta-Chymotrypsin Bo 6e-05
1bda_A 265 Catalytic Domain Of Human Single Chain Tissue Plasm 7e-05
2zch_P 237 Crystal Structure Of Human Prostate Specific Antige 7e-05
4e7n_A 238 Crystal Structure Of Ahv_tl-I, A Glycosylated Snake 7e-05
4gso_A 232 Structure Of Jararacussin-I Length = 232 7e-05
1fi8_A 228 Rat Granzyme B [n66q] Complexed To Ecotin [81-84 Ie 7e-05
1op8_A 234 Crystal Structure Of Human Granzyme A Length = 234 8e-05
1orf_A 234 The Oligomeric Structure Of Human Granzyme A Reveal 8e-05
1h4w_A 224 Structure Of Human Trypsin Iv (Brain Trypsin) Lengt 8e-05
2bdg_A 223 Human Kallikrein 4 Complex With Nickel And P-aminob 9e-05
2r9p_A 224 Human Mesotrypsin Complexed With Bovine Pancreatic 9e-05
1gpz_A 399 The Crystal Structure Of The Zymogen Catalytic Doma 9e-05
1a0j_A 223 Crystal Structure Of A Non-Psychrophilic Trypsin Fr 9e-05
1op2_A 234 Crystal Structure Of Aav-Sp-Ii, A Glycosylated Snak 1e-04
2hnt_C70 Crystallographic Structure Of Human Gamma-Thrombin 1e-04
1mkw_K 308 The Co-Crystal Structure Of Unliganded Bovine Alpha 1e-04
3s9a_A 234 Russell's Viper Venom Serine Proteinase, Rvv-V (Clo 1e-04
1nn6_A 228 Human Pro-Chymase Length = 228 1e-04
4afq_A 226 Human Chymase - Fynomer Complex Length = 226 1e-04
2vnt_A 276 Urokinase-Type Plasminogen Activator Inhibitor Comp 1e-04
3n7o_A 226 X-Ray Structure Of Human Chymase In Complex With Sm 1e-04
2kai_A80 Refined 2.5 Angstroms X-Ray Crystal Structure Of Th 1e-04
1pjp_A 226 The 2.2 A Crystal Structure Of Human Chymase In Com 1e-04
1vzq_H 250 Complex Of Thrombin With Designed Inhibitor 7165 Le 1e-04
4dg4_A 224 Human Mesotrypsin-S39y Complexed With Bovine Pancre 1e-04
1bhx_B147 X-Ray Structure Of The Complex Of Human Alpha Throm 2e-04
2a31_A 223 Trypsin In Complex With Borate Length = 223 2e-04
1h8d_H 260 X-Ray Structure Of The Human Alpha-Thrombin Complex 2e-04
3r3g_B 259 Structure Of Human Thrombin With Residues 145-150 O 2e-04
4f4o_C 347 Structure Of The Haptoglobin-Haemoglobin Complex Le 2e-04
2od3_B 259 Human Thrombin Chimera With Human Residues 184a, 18 2e-04
1tq0_B 257 Crystal Structure Of The Potent Anticoagulant Throm 2e-04
1qur_H 257 Human Alpha-Thrombin In Complex With Bivalent, Benz 2e-04
3gic_B 250 Structure Of Thrombin Mutant Delta(146-149e) In The 2e-04
1b7x_B 259 Structure Of Human Alpha-Thrombin Y225i Mutant Boun 2e-04
2a0q_B 257 Structure Of Thrombin In 400 Mm Potassium Chloride 2e-04
2bvr_H 252 Human Thrombin Complexed With Fragment-based Small 2e-04
2thf_B 259 Structure Of Human Alpha-thrombin Y225f Mutant Boun 2e-04
1bth_H 259 Structure Of Thrombin Complexed With Bovine Pancrea 2e-04
1z8i_B 259 Crystal Structure Of The Thrombin Mutant G193a Boun 2e-04
1abi_H 259 Structure Of The Hirulog 3-Thrombin Complex And Nat 2e-04
1wbg_B 259 Active Site Thrombin Inhibitors Length = 259 2e-04
1h8i_H 253 X-Ray Crystal Structure Of Human Alpha-Thrombin Wit 2e-04
1gj5_H 258 Selectivity At S1, H2o Displacement, Upa, Tpa, Ser1 2e-04
3ee0_B 259 Crystal Structure Of The W215aE217A MUTANT OF HUMAN 2e-04
1z8j_B 259 Crystal Structure Of The Thrombin Mutant G193p Boun 2e-04
1sfq_B 259 Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack 2e-04
2gp9_B 259 Crystal Structure Of The Slow Form Of Thrombin In A 2e-04
1jou_B 259 Crystal Structure Of Native S195a Thrombin With An 2e-04
1rd3_B 259 2.5a Structure Of Anticoagulant Thrombin Variant E2 2e-04
1thp_B 259 Structure Of Human Alpha-Thrombin Y225p Mutant Boun 2e-04
2pgb_B 259 Inhibitor-Free Human Thrombin Mutant C191a-C220a Le 2e-04
1twx_B 259 Crystal Structure Of The Thrombin Mutant D221aD222K 2e-04
3jz1_B 259 Crystal Structure Of Human Thrombin Mutant N143p In 2e-04
1j15_A 223 Benzamidine In Complex With Rat Trypsin Mutant X991 2e-04
3mwi_U 246 The Complex Crystal Structure Of Urokianse And 5-Ni 2e-04
3ig6_B 253 Low Molecular Weigth Human Urokinase Type Plasminog 2e-04
1w0z_U 247 Urokinase Type Plasminogen Activator Length = 247 2e-04
1trm_A 223 The Three-Dimensional Structure Of Asn102 Mutant Of 3e-04
1ejn_A 253 Urokinase Plasminogen Activator B-Chain Inhibitor C 3e-04
1ql9_A 223 Factor Xa Specific Inhibitor In Complex With Rat Tr 3e-04
2nwn_A 253 New Pharmacophore For Serine Protease Inhibition Re 3e-04
4fu7_A 246 Crystal Structure Of The Urokinase Length = 246 3e-04
2o8u_A 253 Crystal Structure And Binding Epitopes Of Urokinase 3e-04
1dpo_A 223 Structure Of Rat Trypsin Length = 223 3e-04
1amh_A 223 Uncomplexed Rat Trypsin Mutant With Asp 189 Replace 3e-04
1ezs_C 223 Crystal Structure Of Ecotin Mutant M84r, W67a, G68a 3e-04
3tgi_E 223 Wild-Type Rat Anionic Trypsin Complexed With Bovine 3e-04
1brb_E 223 Crystal Structures Of Rat Anionic Trypsin Complexed 3e-04
1and_A 223 Anionic Trypsin Mutant With Arg 96 Replaced By His 3e-04
1vr1_H 261 Specifity For Plasminogen Activator Inhibitor-1 Len 3e-04
1anb_A 223 Anionic Trypsin Mutant With Ser 214 Replaced By Glu 3e-04
1k9o_E 223 Crystal Structure Of Michaelis Serpin-Trypsin Compl 3e-04
1anc_A 223 Anionic Trypsin Mutant With Ser 214 Replaced By Lys 3e-04
1slw_B 223 Rat Anionic N143h, E151h Trypsin Complexed To A86h 3e-04
1slx_B 223 Rat Anionic N143h, E151h Trypsin Complexed To A86h 3e-04
3edx_B 258 Crystal Structure Of The W215aE217A MUTANT OF MURIN 3e-04
2ocv_B 259 Structural Basis Of Na+ Activation Mimicry In Murin 3e-04
3bn9_B 241 Crystal Structure Of Mt-Sp1 In Complex With Fab Inh 3e-04
3p8g_A 241 Crystal Structure Of Mt-Sp1 In Complex With Benzami 3e-04
1eaw_A 241 Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (A 3e-04
2pux_B 258 Crystal Structure Of Murine Thrombin In Complex Wit 3e-04
2wub_A 257 Crystal Structure Of Hgfa In Complex With The Allos 4e-04
2r0l_A 248 Short Form Hgfa With Inhibitory Fab75 Length = 248 4e-04
1tgs_Z 229 Three-Dimensional Structure Of The Complex Between 4e-04
1fq3_A 227 Crystal Structure Of Human Granzyme B Length = 227 4e-04
1zzz_A 237 Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes 4e-04
3i78_A 229 3599170186220-Loops Of Fxa In Sgt Length = 229 4e-04
1owd_A 245 Substituted 2-naphthamidine Inhibitors Of Urokinase 4e-04
3i77_A 230 3599170-Loops Of Fxa In Sgt Length = 230 4e-04
1owe_A 245 Substituted 2-Naphthamidine Inhibitors Of Urokinase 4e-04
1gi8_B 245 A Novel Serine Protease Inhibition Motif Involving 4e-04
1f0t_A 243 Bovine Trypsin Complexed With Rpr131247 Length = 24 5e-04
1bbr_H150 The Structure Of Residues 7-16 Of The A Alpha Chain 5e-04
1fon_A 240 Crystal Structure Of Bovine Procarboxypeptidase A-S 5e-04
1fv9_A 245 Crystal Structure Of Human Microurokinase In Comple 5e-04
1iau_A 227 Human Granzyme B In Complex With Ac-Iepd-Cho Length 5e-04
1bbr_K 259 The Structure Of Residues 7-16 Of The A Alpha Chain 5e-04
1lmw_B 253 Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-A 5e-04
1oph_B 243 Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh 5e-04
1dx5_M 259 Crystal Structure Of The Thrombin-Thrombomodulin Co 5e-04
1id5_H 256 Crystal Structure Of Bovine Thrombin Complex With P 5e-04
1gj7_B 253 Engineering Inhibitors Highly Selective For The S1 5e-04
1o5a_B 253 Dissecting And Designing Inhibitor Selectivity Dete 5e-04
1sgf_G 237 Crystal Structure Of 7s Ngf: A Complex Of Nerve Gro 6e-04
1kig_H 241 Bovine Factor Xa Length = 241 7e-04
1rtf_B 252 Complex Of Benzamidine With The Catalytic Domain Of 7e-04
1utj_A 242 Trypsin Specificity As Elucidated By Lie Calculatio 8e-04
>pdb|1QRZ|A Chain A, Catalytic Domain Of Plasminogen Length = 246 Back     alignment and structure

Iteration: 1

Score = 60.8 bits (146), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 34/78 (43%), Positives = 45/78 (57%), Gaps = 5/78 (6%) Query: 35 NCACGQVERNQ---RIVGGNVTKLHEFPWIAAL-TKKGKFYCGATLIAKRHVLTAAHCIE 90 +C QVE + R+VGG V H +PW +L T+ G+ +CG TLI+ VLTAAHC+E Sbjct: 2 DCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGQHFCGGTLISPEWVLTAAHCLE 61 Query: 91 -GVNPKEIKVTLGEHDRL 107 P KV LG H + Sbjct: 62 KSPRPSSYKVILGAHQEV 79
>pdb|4DUR|A Chain A, The X-Ray Crystal Structure Of Full-Length Type Ii Human Plasminogen Length = 791 Back     alignment and structure
>pdb|1BUI|B Chain B, Structure Of The Ternary Microplasmin-Staphylokinase-Microplasmin Complex: A Proteinase-Cofactor-Substrate Complex In Action Length = 250 Back     alignment and structure
>pdb|1BML|A Chain A, Complex Of The Catalytic Domain Of Human Plasmin And Streptokinase Length = 250 Back     alignment and structure
>pdb|1L4Z|A Chain A, X-Ray Crystal Structure Of The Complex Of Microplasminogen With Alpha Domain Of Streptokinase In The Presence Cadmium Ions Length = 248 Back     alignment and structure
>pdb|1L4D|A Chain A, Crystal Structure Of Microplasminogen-streptokinase Alpha Domain Complex Length = 249 Back     alignment and structure
>pdb|3UIR|A Chain A, Crystal Structure Of The Plasmin-Textilinin-1 Complex Length = 247 Back     alignment and structure
>pdb|1DDJ|A Chain A, Crystal Structure Of Human Plasminogen Catalytic Domain Length = 247 Back     alignment and structure
>pdb|2XXL|A Chain A, Crystal Structure Of Drosophila Grass Clip Serine Protease Of Toll Pathway Length = 408 Back     alignment and structure
>pdb|1FY3|A Chain A, [g175q]hbp, A Mutant Of Human Heparin Binding Protein (cap37) Length = 225 Back     alignment and structure
>pdb|1A7S|A Chain A, Atomic Resolution Structure Of Hbp Length = 225 Back     alignment and structure
>pdb|1RJX|B Chain B, Human Plasminogen Catalytic Domain, K698m Mutant Length = 247 Back     alignment and structure
>pdb|1YM0|A Chain A, Crystal Structure Of Earthworm Fibrinolytic Enzyme Component B: A Novel, Glycosylated Two-chained Trypsin Length = 238 Back     alignment and structure
>pdb|1FUJ|A Chain A, Pr3 (Myeloblastin) Length = 221 Back     alignment and structure
>pdb|1FY1|A Chain A, [r23s,F25e]hbp, A Mutant Of Human Heparin Binding Protein (Cap37) Length = 225 Back     alignment and structure
>pdb|1FDP|A Chain A, Proenzyme Of Human Complement Factor D, Recombinant Profactor D Length = 235 Back     alignment and structure
>pdb|1PPG|E Chain E, The Refined 2.3 Angstroms Crystal Structure Of Human Leukocyte Elastase In A Complex With A Valine Chloromethyl Ketone Inhibitor Length = 218 Back     alignment and structure
>pdb|1HNE|E Chain E, Structure Of Human Neutrophil Elastase In Complex With A Peptide Chloromethyl Ketone Inhibitor At 1.84-Angstroms Resolution Length = 218 Back     alignment and structure
>pdb|2RG3|A Chain A, Covalent Complex Structure Of Elastase Length = 218 Back     alignment and structure
>pdb|4D9Q|A Chain A, Inhibiting Alternative Pathway Complement Activation By Targeting The Exosite On Factor D Length = 228 Back     alignment and structure
>pdb|1PPF|E Chain E, X-Ray Crystal Structure Of The Complex Of Human Leukocyte Elastase (Pmn Elastase) And The Third Domain Of The Turkey Ovomucoid Inhibitor Length = 218 Back     alignment and structure
>pdb|2XWA|A Chain A, Crystal Structure Of Complement Factor D Mutant R202a Length = 228 Back     alignment and structure
>pdb|4DGJ|A Chain A, Structure Of A Human Enteropeptidase Light Chain Variant Length = 235 Back     alignment and structure
>pdb|1GDU|A Chain A, Fusarium Oxysporum Trypsin At Atomic Resolution Length = 224 Back     alignment and structure
>pdb|1DSU|A Chain A, Human Factor D, Complement Activating Enzyme Length = 228 Back     alignment and structure
>pdb|1PPZ|A Chain A, Trypsin Complexes At Atomic And Ultra-High Resolution Length = 224 Back     alignment and structure
>pdb|2XW9|A Chain A, Crystal Structure Of Complement Factor D Mutant S183a Length = 228 Back     alignment and structure
>pdb|1DST|A Chain A, Mutant Of Factor D With Enhanced Catalytic Activity Length = 228 Back     alignment and structure
>pdb|1EKB|B Chain B, The Serine Protease Domain Of Enteropeptidase Bound To Inhibitor Val- Asp-asp-asp-asp-lys-chloromethane Length = 235 Back     alignment and structure
>pdb|1B0F|A Chain A, Crystal Structure Of Human Neutrophil Elastase With Mdl 101, 146 Length = 218 Back     alignment and structure
>pdb|3H7T|A Chain A, Crystal Structure Of Scabies Mite Inactivated Protease Paralogue S-D1 (Smipp-S-D1) Length = 235 Back     alignment and structure
>pdb|1SPJ|A Chain A, Structure Of Mature Human Tissue Kallikrein (Human Kallikrein 1 Or Klk1) At 1.70 Angstrom Resolution With Vacant Active Site Length = 238 Back     alignment and structure
>pdb|1XVM|A Chain A, Trypsin From Fusarium Oxysporum- Room Temperature To Atomic Resolution Length = 224 Back     alignment and structure
>pdb|1ELT|A Chain A, Structure Of Native Pancreatic Elastase From North Atlantic Salmon At 1.61 Angstroms Resolution Length = 236 Back     alignment and structure
>pdb|1GVZ|A Chain A, Prostate Specific Antigen (Psa) From Stallion Seminal Plasma Length = 237 Back     alignment and structure
>pdb|2B9L|A Chain A, Crystal Structure Of Prophenoloxidase Activating Factor-Ii From The Beetle Holotrichia Diomphalia Length = 394 Back     alignment and structure
>pdb|2BQ6|B Chain B, Crystal Structure Of Factor Xa In Complex With 21 Length = 249 Back     alignment and structure
>pdb|2OLG|A Chain A, Crystal Structure Of The Serine Protease Domain Of Prophenoloxidase Activating Factor-I In A Zymogen Form Length = 278 Back     alignment and structure
>pdb|1PYT|D Chain D, Ternary Complex Of Procarboxypeptidase A, Proproteinase E, And Chymotrypsinogen C Length = 251 Back     alignment and structure
>pdb|3GYL|B Chain B, Structure Of Prostasin At 1.3 Angstroms Resolution In Complex With A Calcium Ion. Length = 261 Back     alignment and structure
>pdb|3E0P|B Chain B, The X-Ray Structure Of Human Prostasin In Complex With A Covalent Benzoxazole Inhibitor Length = 271 Back     alignment and structure
>pdb|2WPH|S Chain S, Factor Ixa Superactive Triple Mutant Length = 235 Back     alignment and structure
>pdb|2WPI|S Chain S, Factor Ixa Superactive Double Mutant Length = 235 Back     alignment and structure
>pdb|1PFX|C Chain C, Porcine Factor Ixa Length = 235 Back     alignment and structure
>pdb|1YBW|A Chain A, Protease Domain Of Hgfa With No Inhibitor Length = 283 Back     alignment and structure
>pdb|2WPM|S Chain S, Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Length = 235 Back     alignment and structure
>pdb|1RFN|A Chain A, Human Coagulation Factor Ixa In Complex With P-Amino Benzamidine Length = 235 Back     alignment and structure
>pdb|3T2N|A Chain A, Human Hepsin Protease In Complex With The Fab Fragment Of An Inhibitory Antibody Length = 372 Back     alignment and structure
>pdb|3DFJ|A Chain A, Crystal Structure Of Human Prostasin Length = 263 Back     alignment and structure
>pdb|3KCG|H Chain H, Crystal Structure Of The Antithrombin-Factor Ixa- Pentasaccharide Complex Length = 235 Back     alignment and structure
>pdb|1Z8G|A Chain A, Crystal Structure Of The Extracellular Region Of The Transmembrane Serine Protease Hepsin With Covalently Bound Preferred Substrate Length = 372 Back     alignment and structure
>pdb|1BRU|P Chain P, Structure Of Porcine Pancreatic Elastase Complexed With The Elastase Inhibitor Gr143783 Length = 241 Back     alignment and structure
>pdb|3F6U|H Chain H, Crystal Structure Of Human Activated Protein C (Apc) Complexed With Ppack Length = 240 Back     alignment and structure
>pdb|1AUT|C Chain C, Human Activated Protein C Length = 250 Back     alignment and structure
>pdb|1NPM|A Chain A, Neuropsin, A Serine Protease Expressed In The Limbic System Of Mouse Brain Length = 225 Back     alignment and structure
>pdb|1EQ9|A Chain A, Crystal Structure Of Fire Ant Chymotrypsin Complexed To Pmsf Length = 222 Back     alignment and structure
>pdb|1DAN|H Chain H, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 254 Back     alignment and structure
>pdb|2F83|A Chain A, Crystal Structure At 2.9 Angstroms Resolution Of Human Plasma Coagulation Factor Xi Zymogen Length = 625 Back     alignment and structure
>pdb|1AZZ|A Chain A, Fiddler Crab Collagenase Complexed To Ecotin Length = 226 Back     alignment and structure
>pdb|1XKA|C Chain C, Factor Xa Complexed With A Synthetic Inhibitor Fx-2212a,(2s)-(3'- Amidino-3-Biphenylyl)-5-(4-Pyridylamino)pentanoic Acid Length = 235 Back     alignment and structure
>pdb|2Y5F|A Chain A, Factor Xa - Cation Inhibitor Complex Length = 234 Back     alignment and structure
>pdb|1MQ5|A Chain A, Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-chlorophenyl) Amino]carbonyl]phenyl]-4-[(4-methyl-1- piperazinyl)methyl]-2- Thiophenecarboxamide Complexed With Human Factor Xa Length = 233 Back     alignment and structure
>pdb|1FJS|A Chain A, Crystal Structure Of The Inhibitor Zk-807834 (Ci-1031) Complexed With Factor Xa Length = 234 Back     alignment and structure
>pdb|2BOK|A Chain A, Factor Xa- Cation Length = 241 Back     alignment and structure
>pdb|3ENS|B Chain B, Crystal Structure Of Human Fxa In Complex With Methyl (2z)-3-[(3- Chloro-1h-indol-7-yl)amino]-2-cyano-3-{[(3s)-2-oxo-1-(2- oxo-2- Pyrrolidin-1-ylethyl)azepan-3-yl]amino}acrylate Length = 238 Back     alignment and structure
>pdb|1MZA|A Chain A, Crystal Structure Of Human Pro-Granzyme K Length = 240 Back     alignment and structure
>pdb|1HCG|A Chain A, Structure Of Human Des(1-45) Factor Xa At 2.2 Angstroms Resolution Length = 241 Back     alignment and structure
>pdb|2GD4|H Chain H, Crystal Structure Of The Antithrombin-S195a Factor Xa-Pentasaccharide Complex Length = 241 Back     alignment and structure
>pdb|4IGD|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-1 Length = 406 Back     alignment and structure
>pdb|2OQ5|A Chain A, Crystal Structure Of Desc1, A New Member Of The Type Ii Transmembrane Serine Proteinases Family Length = 232 Back     alignment and structure
>pdb|3RP2|A Chain A, The Structure Of Rat Mast Cell Protease Ii At 1.9-Angstroms Resolution Length = 224 Back     alignment and structure
>pdb|1EZQ|A Chain A, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr128515 Length = 254 Back     alignment and structure
>pdb|1C5M|D Chain D, Structural Basis For Selectivity Of A Small Molecule, S1- Binding, Sub-Micromolar Inhibitor Of Urokinase Type Plasminogen Activator Length = 255 Back     alignment and structure
>pdb|2CGA|A Chain A, Bovine Chymotrypsinogen A. X-Ray Crystal Structure Analysis And Refinement Of A New Crystal Form At 1.8 Angstroms Resolution Length = 245 Back     alignment and structure
>pdb|1A5I|A Chain A, Catalytic Domain Of Vampire Bat (Desmodus Rotundus) Saliva Plasminogen Activator In Complex With Egr-Cmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 265 Back     alignment and structure
>pdb|1O5E|H Chain H, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (ala190 Upa) Length = 255 Back     alignment and structure
>pdb|1A0L|A Chain A, Human Beta-Tryptase: A Ring-Like Tetramer With Active Sites Facing A Central Pore Length = 244 Back     alignment and structure
>pdb|2ZEB|A Chain A, Potent, Nonpeptide Inhibitors Of Human Mast Cell Tryptase Length = 243 Back     alignment and structure
>pdb|4H4F|A Chain A, Crystal Structure Of Human Chymotrypsin C (ctrc) Bound To Inhibitor Eglin C From Hirudo Medicinalis Length = 249 Back     alignment and structure
>pdb|2BM2|A Chain A, Human Beta-Ii Tryptase In Complex With 4-(3-Aminomethyl- Phenyl)-Piperidin-1-Yl-(5-Phenethyl- Pyridin-3-Yl)- Methanone Length = 245 Back     alignment and structure
>pdb|4AN7|A Chain A, Kunitz Type Trypsin Inhibitor Complex With Porcine Trypsin Length = 231 Back     alignment and structure
>pdb|1FXY|A Chain A, Coagulation Factor Xa-Trypsin Chimera Inhibited With D-Phe-Pro-Arg- Chloromethylketone Length = 228 Back     alignment and structure
>pdb|3FZZ|A Chain A, Structure Of Grc Length = 227 Back     alignment and structure
>pdb|3G01|A Chain A, Structure Of Grc Mutant E192rE193G Length = 227 Back     alignment and structure
>pdb|1KDQ|A Chain A, Crystal Structure Analysis Of The Mutant S189d Rat Chymotrypsin Length = 131 Back     alignment and structure
>pdb|3NXP|A Chain A, Crystal Structure Of Human Prethrombin-1 Length = 424 Back     alignment and structure
>pdb|2F9N|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant K192qD216G IN COMPLEX WITH LEUPEPTIN Length = 245 Back     alignment and structure
>pdb|2F9O|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant D216g Length = 245 Back     alignment and structure
>pdb|1LTO|A Chain A, Human Alpha1-Tryptase Length = 245 Back     alignment and structure
>pdb|3GOV|B Chain B, Crystal Structure Of The Catalytic Region Of Human Masp-1 Length = 251 Back     alignment and structure
>pdb|1EUF|A Chain A, Bovine Duodenase(New Serine Protease), Crystal Structure Length = 227 Back     alignment and structure
>pdb|2ZGC|A Chain A, Crystal Structure Of Active Human Granzyme M Length = 240 Back     alignment and structure
>pdb|2ZGJ|A Chain A, Crystal Structure Of D86n-gzmm Complexed With Its Optimal Synthesized Substrate Length = 240 Back     alignment and structure
>pdb|2ANY|A Chain A, Expression, Crystallization And The Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 Back     alignment and structure
>pdb|1MD8|A Chain A, Monomeric Structure Of The Active Catalytic Domain Of Complement Protease C1r Length = 329 Back     alignment and structure
>pdb|1MD7|A Chain A, Monomeric Structure Of The Zymogen Of Complement Protease C1r Length = 328 Back     alignment and structure
>pdb|3TGJ|E Chain E, S195a Trypsinogen Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 233 Back     alignment and structure
>pdb|2ANW|A Chain A, Expression, Crystallization And Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 Back     alignment and structure
>pdb|1FAX|A Chain A, Coagulation Factor Xa Inhibitor Complex Length = 254 Back     alignment and structure
>pdb|1CO7|E Chain E, R117h Mutant Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 245 Back     alignment and structure
>pdb|1PYT|C Chain C, Ternary Complex Of Procarboxypeptidase A, Proproteinase E, And Chymotrypsinogen C Length = 253 Back     alignment and structure
>pdb|2PSX|A Chain A, Crystal Structure Of Human Kallikrein 5 In Complex With Leupeptin Length = 227 Back     alignment and structure
>pdb|2JET|B Chain B, Crystal Structure Of A Trypsin-Like Mutant (S189d, A226g) Chymotrypsin Length = 128 Back     alignment and structure
>pdb|3ELA|H Chain H, Crystal Structure Of Active Site Inhibited Coagulation Factor Viia Mutant In Complex With Soluble Tissue Factor Length = 254 Back     alignment and structure
>pdb|2F91|A Chain A, 1.2a Resolution Structure Of A Crayfish Trypsin Complexed With A Peptide Inhibitor, Sgti Length = 237 Back     alignment and structure
>pdb|1AU8|A Chain A, Human Cathepsin G Length = 224 Back     alignment and structure
>pdb|1KYN|B Chain B, Cathepsin-G Length = 235 Back     alignment and structure
>pdb|3TJU|A Chain A, Crystal Structure Of Human Granzyme H With An Inhibitor Length = 226 Back     alignment and structure
>pdb|4GAW|A Chain A, Crystal Structure Of Active Human Granzyme H Length = 226 Back     alignment and structure
>pdb|1ZJD|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 237 Back     alignment and structure
>pdb|1MH0|A Chain A, Crystal Structure Of The Anticoagulant Slow Form Of Thrombin Length = 287 Back     alignment and structure
>pdb|2BDY|A Chain A, Thrombin In Complex With Inhibitor Length = 289 Back     alignment and structure
>pdb|1ZLR|A Chain A, Factor Xi Catalytic Domain Complexed With 2-Guanidino-1-(4-(4,4,5,5- Tetramethyl-1,3,2-Dioxaborolan-2-Yl)phenyl)ethyl Nicotinate Length = 237 Back     alignment and structure
>pdb|1XX9|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Ecotinm84r Length = 238 Back     alignment and structure
>pdb|1ZPZ|A Chain A, Factor Xi Catalytic Domain Complexed With N-((R)-1-(4- Bromophenyl)ethyl)urea-Asn-Val-Arg-Alpha-Ketothiazole Length = 238 Back     alignment and structure
>pdb|1ZHM|A Chain A, Crystal Structure Of The Catalytic Domain Of The Coagulation Factor Xia In Complex With Benzamidine (s434a- T475a-k437 Mutant) Length = 238 Back     alignment and structure
>pdb|1ZHP|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-K505 Mutant) Length = 238 Back     alignment and structure
>pdb|1D9I|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 288 Back     alignment and structure
>pdb|3SOR|A Chain A, Factor Xia In Complex With A Clorophenyl-tetrazole Inhibitor Length = 238 Back     alignment and structure
>pdb|3BG8|A Chain A, Crystal Structure Of Factor Xia In Complex With Clavatadine A Length = 238 Back     alignment and structure
>pdb|1KLT|A Chain A, Crystal Structure Of Pmsf-Treated Human Chymase At 1.9 Angstroms Resolution Length = 226 Back     alignment and structure
>pdb|1EOJ|A Chain A, Design Of P1' And P3' Residues Of Trivalent Thrombin Inhibitors And Their Crystal Structures Length = 289 Back     alignment and structure
>pdb|1ZHR|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-C482s-K437a Mutant) Length = 238 Back     alignment and structure
>pdb|1JWT|A Chain A, Crystal Structure Of Thrombin In Complex With A Novel Bicyclic Lactam Inhibitor Length = 305 Back     alignment and structure
>pdb|3SQE|E Chain E, Crystal Structure Of Prethrombin-2 Mutant S195a In The Alternative Form Length = 290 Back     alignment and structure
>pdb|1ELV|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Complement C1s Protease Length = 333 Back     alignment and structure
>pdb|1MCT|A Chain A, The Refined 1.6 Angstroms Resolution Crystal Structure Of The Complex Formed Between Porcine Beta-trypsin And Mcti-a, A Trypsin Inhibitor Of Squash Family Length = 223 Back     alignment and structure
>pdb|1D6W|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electrophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 287 Back     alignment and structure
>pdb|1XXD|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Mutated Ecotin Length = 238 Back     alignment and structure
>pdb|1NM6|A Chain A, Thrombin In Complex With Selective Macrocyclic Inhibitor At 1.8a Length = 287 Back     alignment and structure
>pdb|1NU9|A Chain A, Staphylocoagulase-prethrombin-2 Complex Length = 291 Back     alignment and structure
>pdb|1DM4|B Chain B, Ser195ala Mutant Of Human Thrombin Complexed With Fibrinopeptide A (7- 16) Length = 260 Back     alignment and structure
>pdb|1HAG|E Chain E, The Isomorphous Structures Of Prethrombin2, Hirugen-And Ppack- Thrombin: Changes Accompanying Activation And Exosite Binding To Thrombin Length = 295 Back     alignment and structure
>pdb|3K65|B Chain B, Crystal Structure Of Prethombin-2FRAGMENT-2 Complex Length = 308 Back     alignment and structure
>pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 223 Back     alignment and structure
>pdb|1AN1|E Chain E, Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Length = 223 Back     alignment and structure
>pdb|1SC8|U Chain U, Urokinase Plasminogen Activator B-Chain-J435 Complex Length = 262 Back     alignment and structure
>pdb|1MTN|B Chain B, Bovine Alpha-Chymotrypsin:bpti Crystallization Length = 131 Back     alignment and structure
>pdb|1OP0|A Chain A, Crystal Structure Of Aav-sp-i, A Glycosylated Snake Venom Serine Proteinase From Agkistrodon Acutus Length = 234 Back     alignment and structure
>pdb|2XRC|A Chain A, Human Complement Factor I Length = 565 Back     alignment and structure
>pdb|1AKS|A Chain A, Crystal Structure Of The First Active Autolysate Form Of The Porcine Alpha Trypsin Length = 125 Back     alignment and structure
>pdb|3MYW|A Chain A, The Bowman-Birk Type Inhibitor From Mung Bean In Ternary Complex With Porcine Trypsin Length = 223 Back     alignment and structure
>pdb|1F7Z|A Chain A, Rat Trypsinogen K15a Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 233 Back     alignment and structure
>pdb|1DLK|B Chain B, Crystal Structure Analysis Of Delta-Chymotrypsin Bound To A Peptidyl Chloromethyl Ketone Inhibitor Length = 230 Back     alignment and structure
>pdb|1BDA|A Chain A, Catalytic Domain Of Human Single Chain Tissue Plasminogen Activator In Complex With Dansyl-Egr-Cmk (Dansyl-Glu-Gly-Arg Chloromethyl Ketone) Length = 265 Back     alignment and structure
>pdb|2ZCH|P Chain P, Crystal Structure Of Human Prostate Specific Antigen Complexed With An Activating Antibody Length = 237 Back     alignment and structure
>pdb|4E7N|A Chain A, Crystal Structure Of Ahv_tl-I, A Glycosylated Snake-Venom Thrombin- Like Enzyme From Agkistrodon Halys Length = 238 Back     alignment and structure
>pdb|4GSO|A Chain A, Structure Of Jararacussin-I Length = 232 Back     alignment and structure
>pdb|1FI8|A Chain A, Rat Granzyme B [n66q] Complexed To Ecotin [81-84 Iepd] Length = 228 Back     alignment and structure
>pdb|1OP8|A Chain A, Crystal Structure Of Human Granzyme A Length = 234 Back     alignment and structure
>pdb|1ORF|A Chain A, The Oligomeric Structure Of Human Granzyme A Reveals The Molecular Determinants Of Substrate Specificity Length = 234 Back     alignment and structure
>pdb|1H4W|A Chain A, Structure Of Human Trypsin Iv (Brain Trypsin) Length = 224 Back     alignment and structure
>pdb|2BDG|A Chain A, Human Kallikrein 4 Complex With Nickel And P-aminobenzamidine Length = 223 Back     alignment and structure
>pdb|2R9P|A Chain A, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor(Bpti) Length = 224 Back     alignment and structure
>pdb|1GPZ|A Chain A, The Crystal Structure Of The Zymogen Catalytic Domain Of Complement Protease C1r Length = 399 Back     alignment and structure
>pdb|1A0J|A Chain A, Crystal Structure Of A Non-Psychrophilic Trypsin From A Cold-Adapted Fish Species. Length = 223 Back     alignment and structure
>pdb|1OP2|A Chain A, Crystal Structure Of Aav-Sp-Ii, A Glycosylated Snake Venom Serine Proteinase From Agkistrodon Acutus Length = 234 Back     alignment and structure
>pdb|2HNT|C Chain C, Crystallographic Structure Of Human Gamma-Thrombin Length = 70 Back     alignment and structure
>pdb|1MKW|K Chain K, The Co-Crystal Structure Of Unliganded Bovine Alpha- Thrombin And Prethrombin-2: Movement Of The Yppw Segment And Active Site Residues Upon Ligand Binding Length = 308 Back     alignment and structure
>pdb|3S9A|A Chain A, Russell's Viper Venom Serine Proteinase, Rvv-V (Closed-Form) Length = 234 Back     alignment and structure
>pdb|1NN6|A Chain A, Human Pro-Chymase Length = 228 Back     alignment and structure
>pdb|4AFQ|A Chain A, Human Chymase - Fynomer Complex Length = 226 Back     alignment and structure
>pdb|2VNT|A Chain A, Urokinase-Type Plasminogen Activator Inhibitor Complex With A 1-(7-Sulphoamidoisoquinolinyl)guanidine Length = 276 Back     alignment and structure
>pdb|3N7O|A Chain A, X-Ray Structure Of Human Chymase In Complex With Small Molecule Inhibitor Length = 226 Back     alignment and structure
>pdb|2KAI|A Chain A, Refined 2.5 Angstroms X-Ray Crystal Structure Of The Complex Formed By Porcine Kallikrein A And The Bovine Pancreatic Trypsin Inhibitor. Crystallization, Patterson Search, Structure Determination, Refinement, Structure And Comparison With Its Components And With The Bovine Trypsin- Pancreatic Trypsin Inhibitor Complex Length = 80 Back     alignment and structure
>pdb|1PJP|A Chain A, The 2.2 A Crystal Structure Of Human Chymase In Complex With Succinyl- Ala-Ala-Pro-Phe-Chloromethylketone Length = 226 Back     alignment and structure
>pdb|1VZQ|H Chain H, Complex Of Thrombin With Designed Inhibitor 7165 Length = 250 Back     alignment and structure
>pdb|4DG4|A Chain A, Human Mesotrypsin-S39y Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 224 Back     alignment and structure
>pdb|1BHX|B Chain B, X-Ray Structure Of The Complex Of Human Alpha Thrombin With The Inhibitor Sdz 229-357 Length = 147 Back     alignment and structure
>pdb|2A31|A Chain A, Trypsin In Complex With Borate Length = 223 Back     alignment and structure
>pdb|1H8D|H Chain H, X-Ray Structure Of The Human Alpha-Thrombin Complex With A Tripeptide Phosphonate Inhibitor Length = 260 Back     alignment and structure
>pdb|3R3G|B Chain B, Structure Of Human Thrombin With Residues 145-150 Of Murine Thrombin Length = 259 Back     alignment and structure
>pdb|4F4O|C Chain C, Structure Of The Haptoglobin-Haemoglobin Complex Length = 347 Back     alignment and structure
>pdb|2OD3|B Chain B, Human Thrombin Chimera With Human Residues 184a, 186, 186a, 186b, 186c And 222 Replaced By Murine Thrombin Equivalents Length = 259 Back     alignment and structure
>pdb|1TQ0|B Chain B, Crystal Structure Of The Potent Anticoagulant Thrombin Mutant W215aE217A IN FREE FORM Length = 257 Back     alignment and structure
>pdb|1QUR|H Chain H, Human Alpha-Thrombin In Complex With Bivalent, Benzamidine-Based Synthetic Inhibitor Length = 257 Back     alignment and structure
>pdb|3GIC|B Chain B, Structure Of Thrombin Mutant Delta(146-149e) In The Free Form Length = 250 Back     alignment and structure
>pdb|1B7X|B Chain B, Structure Of Human Alpha-Thrombin Y225i Mutant Bound To D- Phe-Pro-Arg-Chloromethylketone Length = 259 Back     alignment and structure
>pdb|2A0Q|B Chain B, Structure Of Thrombin In 400 Mm Potassium Chloride Length = 257 Back     alignment and structure
>pdb|2BVR|H Chain H, Human Thrombin Complexed With Fragment-based Small Molecules Occupying The S1 Pocket Length = 252 Back     alignment and structure
>pdb|2THF|B Chain B, Structure Of Human Alpha-thrombin Y225f Mutant Bound To D-phe-pro-arg- Chloromethylketone Length = 259 Back     alignment and structure
>pdb|1BTH|H Chain H, Structure Of Thrombin Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 259 Back     alignment and structure
>pdb|1Z8I|B Chain B, Crystal Structure Of The Thrombin Mutant G193a Bound To Ppack Length = 259 Back     alignment and structure
>pdb|1ABI|H Chain H, Structure Of The Hirulog 3-Thrombin Complex And Nature Of The S' Subsites Of Substrates And Inhibitors Length = 259 Back     alignment and structure
>pdb|1WBG|B Chain B, Active Site Thrombin Inhibitors Length = 259 Back     alignment and structure
>pdb|1H8I|H Chain H, X-Ray Crystal Structure Of Human Alpha-Thrombin With A Tripeptide Phosphonate Inhibitor Length = 253 Back     alignment and structure
>pdb|1GJ5|H Chain H, Selectivity At S1, H2o Displacement, Upa, Tpa, Ser190ALA190 PROTEASE, Structure-Based Drug Design Length = 258 Back     alignment and structure
>pdb|3EE0|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF HUMAN Thrombin (Space Group P2(1)2(1)2(1)) Length = 259 Back     alignment and structure
>pdb|1Z8J|B Chain B, Crystal Structure Of The Thrombin Mutant G193p Bound To Ppack Length = 259 Back     alignment and structure
>pdb|1SFQ|B Chain B, Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack Length = 259 Back     alignment and structure
>pdb|2GP9|B Chain B, Crystal Structure Of The Slow Form Of Thrombin In A Self- Inhibited Conformation Length = 259 Back     alignment and structure
>pdb|1JOU|B Chain B, Crystal Structure Of Native S195a Thrombin With An Unoccupied Active Site Length = 259 Back     alignment and structure
>pdb|1RD3|B Chain B, 2.5a Structure Of Anticoagulant Thrombin Variant E217k Length = 259 Back     alignment and structure
>pdb|1THP|B Chain B, Structure Of Human Alpha-Thrombin Y225p Mutant Bound To D-Phe-Pro-Arg- Chloromethylketone Length = 259 Back     alignment and structure
>pdb|2PGB|B Chain B, Inhibitor-Free Human Thrombin Mutant C191a-C220a Length = 259 Back     alignment and structure
>pdb|1TWX|B Chain B, Crystal Structure Of The Thrombin Mutant D221aD222K Length = 259 Back     alignment and structure
>pdb|3JZ1|B Chain B, Crystal Structure Of Human Thrombin Mutant N143p In E:na+ Form Length = 259 Back     alignment and structure
>pdb|1J15|A Chain A, Benzamidine In Complex With Rat Trypsin Mutant X99175190RT Length = 223 Back     alignment and structure
>pdb|3MWI|U Chain U, The Complex Crystal Structure Of Urokianse And 5-Nitro-1h-Indole-2- Amidine Length = 246 Back     alignment and structure
>pdb|3IG6|B Chain B, Low Molecular Weigth Human Urokinase Type Plasminogen Activator 2-[6- (3'-Aminomethyl-Biphenyl-3-Yloxy)-4-(3-Dimethylamino- Pyrrolidin-1- Yl)-3, 5-Difluoro-Pyridin-2-Yloxy]-4-Dimethylamino-Benzoic Acid Complex Length = 253 Back     alignment and structure
>pdb|1W0Z|U Chain U, Urokinase Type Plasminogen Activator Length = 247 Back     alignment and structure
>pdb|1TRM|A Chain A, The Three-Dimensional Structure Of Asn102 Mutant Of Trypsin. Role Of Asp102 In Serine Protease Catalysis Length = 223 Back     alignment and structure
>pdb|1EJN|A Chain A, Urokinase Plasminogen Activator B-Chain Inhibitor Complex Length = 253 Back     alignment and structure
>pdb|1QL9|A Chain A, Factor Xa Specific Inhibitor In Complex With Rat Trypsin Mutant X99rt Length = 223 Back     alignment and structure
>pdb|2NWN|A Chain A, New Pharmacophore For Serine Protease Inhibition Revealed By Crystal Structure Of Human Urokinase-Type Plasminogen Activator Complexed With A Cyclic Peptidyl Inhibitor, Upain-1 Length = 253 Back     alignment and structure
>pdb|4FU7|A Chain A, Crystal Structure Of The Urokinase Length = 246 Back     alignment and structure
>pdb|2O8U|A Chain A, Crystal Structure And Binding Epitopes Of Urokinase-Type Plasminogen Activator (C122aN145QS195A) IN COMPLEX WITH Inhibitors Length = 253 Back     alignment and structure
>pdb|1DPO|A Chain A, Structure Of Rat Trypsin Length = 223 Back     alignment and structure
>pdb|1AMH|A Chain A, Uncomplexed Rat Trypsin Mutant With Asp 189 Replaced With Ser (D189s) Length = 223 Back     alignment and structure
>pdb|1EZS|C Chain C, Crystal Structure Of Ecotin Mutant M84r, W67a, G68a, Y69a, D70a Bound To Rat Anionic Trypsin Ii Length = 223 Back     alignment and structure
>pdb|3TGI|E Chain E, Wild-Type Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 223 Back     alignment and structure
>pdb|1BRB|E Chain E, Crystal Structures Of Rat Anionic Trypsin Complexed With The Protein Inhibitors Appi And Bpti Length = 223 Back     alignment and structure
>pdb|1AND|A Chain A, Anionic Trypsin Mutant With Arg 96 Replaced By His Length = 223 Back     alignment and structure
>pdb|1VR1|H Chain H, Specifity For Plasminogen Activator Inhibitor-1 Length = 261 Back     alignment and structure
>pdb|1ANB|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Glu Length = 223 Back     alignment and structure
>pdb|1K9O|E Chain E, Crystal Structure Of Michaelis Serpin-Trypsin Complex Length = 223 Back     alignment and structure
>pdb|1ANC|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Lys Length = 223 Back     alignment and structure
>pdb|1SLW|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Nickel- Bound Length = 223 Back     alignment and structure
>pdb|1SLX|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Zinc-Bound Length = 223 Back     alignment and structure
>pdb|3EDX|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF MURINE THROMBIN Length = 258 Back     alignment and structure
>pdb|2OCV|B Chain B, Structural Basis Of Na+ Activation Mimicry In Murine Thrombin Length = 259 Back     alignment and structure
>pdb|3BN9|B Chain B, Crystal Structure Of Mt-Sp1 In Complex With Fab Inhibitor E2 Length = 241 Back     alignment and structure
>pdb|3P8G|A Chain A, Crystal Structure Of Mt-Sp1 In Complex With Benzamidine Length = 241 Back     alignment and structure
>pdb|1EAW|A Chain A, Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (Aprotinin) Complex Length = 241 Back     alignment and structure
>pdb|2PUX|B Chain B, Crystal Structure Of Murine Thrombin In Complex With The Extracellular Fragment Of Murine Par3 Length = 258 Back     alignment and structure
>pdb|2WUB|A Chain A, Crystal Structure Of Hgfa In Complex With The Allosteric Non-Inhibitory Antibody Fab40.Deltatrp Length = 257 Back     alignment and structure
>pdb|2R0L|A Chain A, Short Form Hgfa With Inhibitory Fab75 Length = 248 Back     alignment and structure
>pdb|1TGS|Z Chain Z, Three-Dimensional Structure Of The Complex Between Pancreatic Secretory Inhibitor (Kazal Type) And Trypsinogen At 1.8 Angstroms Resolution. Structure Solution, Crystallographic Refinement And Preliminary Structural Interpretation Length = 229 Back     alignment and structure
>pdb|1FQ3|A Chain A, Crystal Structure Of Human Granzyme B Length = 227 Back     alignment and structure
>pdb|1ZZZ|A Chain A, Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes Length = 237 Back     alignment and structure
>pdb|3I78|A Chain A, 3599170186220-Loops Of Fxa In Sgt Length = 229 Back     alignment and structure
>pdb|1OWD|A Chain A, Substituted 2-naphthamidine Inhibitors Of Urokinase Length = 245 Back     alignment and structure
>pdb|3I77|A Chain A, 3599170-Loops Of Fxa In Sgt Length = 230 Back     alignment and structure
>pdb|1OWE|A Chain A, Substituted 2-Naphthamidine Inhibitors Of Urokinase Length = 245 Back     alignment and structure
>pdb|1GI8|B Chain B, A Novel Serine Protease Inhibition Motif Involving A Multi- Centered Short Hydrogen Bonding Network At The Active Site Length = 245 Back     alignment and structure
>pdb|1F0T|A Chain A, Bovine Trypsin Complexed With Rpr131247 Length = 243 Back     alignment and structure
>pdb|1BBR|H Chain H, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 150 Back     alignment and structure
>pdb|1FON|A Chain A, Crystal Structure Of Bovine Procarboxypeptidase A-S6 Subunit Iii, A Highly Structured Truncated Zymogen E Length = 240 Back     alignment and structure
>pdb|1FV9|A Chain A, Crystal Structure Of Human Microurokinase In Complex With 2- Amino-5-Hydroxy-Benzimidazole Length = 245 Back     alignment and structure
>pdb|1IAU|A Chain A, Human Granzyme B In Complex With Ac-Iepd-Cho Length = 227 Back     alignment and structure
>pdb|1BBR|K Chain K, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|1LMW|B Chain B, Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 253 Back     alignment and structure
>pdb|1OPH|B Chain B, Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh And S195a Trypsin Length = 243 Back     alignment and structure
>pdb|1DX5|M Chain M, Crystal Structure Of The Thrombin-Thrombomodulin Complex Length = 259 Back     alignment and structure
>pdb|1ID5|H Chain H, Crystal Structure Of Bovine Thrombin Complex With Protease Inhibitor Ecotin Length = 256 Back     alignment and structure
>pdb|1GJ7|B Chain B, Engineering Inhibitors Highly Selective For The S1 Sites Of Ser190 Trypsin-Like Serine Protease Drug Targets Length = 253 Back     alignment and structure
>pdb|1O5A|B Chain B, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (Ala190 Upa) Length = 253 Back     alignment and structure
>pdb|1SGF|G Chain G, Crystal Structure Of 7s Ngf: A Complex Of Nerve Growth Factor With Four Binding Proteins (serine Proteinases) Length = 237 Back     alignment and structure
>pdb|1KIG|H Chain H, Bovine Factor Xa Length = 241 Back     alignment and structure
>pdb|1RTF|B Chain B, Complex Of Benzamidine With The Catalytic Domain Of Human Two Chain Tissue Plasminogen Activator [(Tc)-T-Pa] Length = 252 Back     alignment and structure
>pdb|1UTJ|A Chain A, Trypsin Specificity As Elucidated By Lie Calculations, X-Ray Structures And Association Constant Measurements Length = 242 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
2xxl_A 408 GRAM-positive specific serine protease, isoform B; 2e-31
1zjk_A 403 Mannan-binding lectin serine protease 2; beta barr 1e-29
2olg_A 278 Pro-phenoloxidase activating enzyme-I; prophenolox 8e-29
2bdy_A 289 Thrombin; thrombin, complex structure, hydrolase, 1e-28
3nxp_A 424 Prethrombin-1; allostery, blood coagulation, hydro 5e-28
3h7t_A 235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 2e-27
2b9l_A 394 Prophenoloxidase activating factor; CLIP domain, e 7e-27
1pq7_A 224 Trypsin; ultra-high resolution, catalysis, hydrola 8e-27
2z7f_E 218 Leukocyte elastase; serine protease, serine protea 1e-26
1yc0_A 283 Hepatocyte growth factor activator; hydrolase/inhi 1e-26
1ym0_A 238 Fibrinotic enzyme component B; two chains, glycosy 2e-26
1z8g_A 372 Serine protease hepsin; serine protease hepsin, pr 2e-26
2wph_S 235 Coagulation factor IXA heavy chain; serine proteas 2e-26
2jde_A 276 Urokinase-type plasminogen activator; plasminogen 3e-26
1md8_A 329 C1R complement serine protease; innate immunity, a 4e-26
2bz6_H 254 Blood coagulation factor VIIA; serine protease, en 4e-26
4dgj_A 235 Enteropeptidase catalytic light chain; serine prot 6e-26
1a7s_A 225 Heparin binding protein; serine protease homolog, 1e-25
1gpz_A 399 Complement C1R component; hydrolase, activation, i 3e-25
1elv_A 333 Complement C1S component; trypsin-like serin prote 3e-25
2jkh_A 241 Activated factor XA heavy chain; plasma, calcium, 5e-25
3tvj_B 242 Mannan-binding lectin serine protease 2 B chain; i 8e-25
3rm2_H 259 Thrombin heavy chain; serine protease, kringle, hy 3e-24
1m9u_A 241 Earthworm fibrinolytic enzyme; hydrolase, serine p 4e-24
3beu_A 224 Trypsin, SGT; beta sheets, serine protease, hydrol 5e-24
1mza_A 240 Pro-granzyme K; apoptosis, serine protease, S1 fam 6e-24
2xw9_A 228 Complement factor D; immune system, hydrolase, ser 7e-24
2odp_A 509 Complement C2; C3/C5 convertase, complement serin 8e-24
1aut_C 250 Activated protein C; serine proteinase, plasma cal 1e-23
2r0l_A 248 Hepatocyte growth factor activator; serine proteas 2e-23
2oq5_A 232 Transmembrane protease, serine 11E; type II trans- 2e-23
1eq9_A 222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 2e-23
1fuj_A 221 PR3, myeloblastin; hydrolase, serine protease, gly 3e-23
2zgc_A 240 Granzyme M; serine protease, cytolysis, glycoprote 4e-23
1ddj_A 247 Plasminogen; catalytic domain, blood clotting; 2.0 5e-23
2xrc_A 565 Human complement factor I; immune system, hydrolas 5e-23
1pyt_D 251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 6e-23
1rtf_B 252 (TC)-T-PA, two chain tissue plasminogen activator; 7e-23
2f91_A 237 Hepatopancreas trypsin; trypsin, canonical inhibit 1e-22
2f83_A 625 Coagulation factor XI; protease, apple domain, hyd 1e-22
1azz_A 226 Collagenase; complex (serine protease/inhibitor), 2e-22
3s69_A 234 Thrombin-like enzyme defibrase; beta-barrel, serin 2e-22
2qy0_B 242 Complement C1R subcomponent; serine protease, beta 3e-22
3gov_B 251 MAsp-1; complement, serine protease, beta barrel, 3e-22
1sgf_A 240 7S NGF, nerve growth factor; growth factor (beta-N 3e-22
1fxy_A 228 Coagulation factor XA-trypsin chimera; protease, c 4e-22
3ncl_A 241 Suppressor of tumorigenicity 14 protein; proteinas 4e-22
2any_A 241 Kininogenin, plasma kallikrein, light chain, fletc 4e-22
3gyl_B 261 Prostasin; ENAC, zymogen, divalent cation, channel 4e-22
2pka_A80 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 7e-22
3mhw_U 247 Urokinase-type plasminogen activator; hydrolase, b 9e-22
1spj_A 238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 1e-21
1lo6_A 223 Kallikrein 6, HK6; serine protease, human kallikre 1e-21
2bdg_A 223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 1e-21
1orf_A 234 Granzyme A; hydrolase-hydrolase inhibitor complex; 2e-21
1npm_A 225 Neuropsin; serine proteinase, glycoprotein; HET: N 2e-21
2qxi_A 224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 2e-21
2f9n_A 245 Alpha I tryptase; serine proteinase, trypsin-like, 2e-21
3h7o_A 228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 2e-21
3bg8_A 238 Coagulation factor XIA light chain; protease inhib 3e-21
1gvz_A 237 Kallikrein-1E2; antigen, prostate specific antigen 4e-21
1t8o_A 245 Chymotrypsin A; chymotrypsin, serine proteinase, B 4e-21
2hlc_A 230 Collagenase; serine protease, hydrolase, collagen 9e-21
2zch_P 237 Prostate-specific antigen; human PSA, kallikrein r 1e-20
1iau_A 227 Granzyme B; hydrolase-hydrolase inhibitor complex; 1e-20
1si5_H 240 Scatter factor, hepatocyte growth factor, SF, hepa 3e-20
2psx_A 227 Kallikrein-5; zinc inhibition, stratum corneum, gl 3e-20
4e7n_A 238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 3e-20
1ao5_A 237 Glandular kallikrein-13; serine protease, protein 4e-20
1cgh_A 224 Cathepsin G; inflammation, specificity, serine pro 4e-20
3s9c_A 234 Vipera russelli proteinase RVV-V gamma; serine pro 5e-20
2aiq_A 231 Protein C activator; snake venom serine proteinase 6e-20
1fiw_A 290 Beta-acrosin heavy chain; anti-parallel beta-barre 7e-20
1rrk_A 497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 9e-20
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 1e-19
3rp2_A 224 RAT MAST cell protease II; serine proteinase; 1.90 1e-19
1euf_A 227 Duodenase; serine protease, dual specificity, hydr 2e-19
4ag1_A 226 Chymase; hydrolase-de novo protein complex, inhibi 2e-19
1elt_A 236 Elastase; serine proteinase; 1.61A {Salmo salar} S 2e-19
1bru_P 241 Elastase, PPE; serine protease, hydrolase; HET: 1N 2e-19
3fzz_A 227 Granzyme C; hydrolase, cytolysis, protease, serine 3e-19
1gvk_B 240 Elastase 1, peptide inhibitor; hydrolase, serine p 4e-19
1hj8_A 222 Trypsin I; hydrolase, radiation damage, disulphide 4e-19
1ton_A 235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 8e-19
3mfj_A 223 Cationic trypsin; serine proteinase, hydrolase; 0. 1e-18
3f1s_B 283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 5e-18
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 9e-18
3hrz_D 741 Complement factor B; serine protease, glycosilated 1e-17
1fon_A 240 Procarboxypeptidase A-S6; truncated zymogen E, ser 3e-16
2asu_B 234 Hepatocyte growth factor-like protein; serine prot 1e-15
4dur_A 791 Plasminogen, serine protease; fibrinolysis, hydrol 3e-15
1p3c_A 215 Glutamyl-endopeptidase; serine protease, hydrolase 9e-08
2o8l_A 274 V8 protease, taphylococcal serine; serine protease 3e-07
1wcz_A 268 Glutamyl endopeptidase; virulence factor, hydrolas 2e-06
3cp7_A 218 Alkaline serine protease Al20; trypsin-like, hydro 3e-05
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Length = 408 Back     alignment and structure
 Score =  113 bits (285), Expect = 2e-31
 Identities = 30/101 (29%), Positives = 50/101 (49%), Gaps = 5/101 (4%)

Query: 18  DFNVDDLTTINSSMNHCNCACGQVERNQRIVGGNVTKLHEFPWIAAL----TKKGKFYCG 73
             N+   + + S     N  CG    +QR+  G   KL   PW+A L      + +F CG
Sbjct: 91  SANIQHNSKVMSLFKDENFDCGNF-LSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCG 149

Query: 74  ATLIAKRHVLTAAHCIEGVNPKEIKVTLGEHDRLSKNESVP 114
             +I++R++LTAAHC+ G+     ++ LGEH   ++ +   
Sbjct: 150 GAMISERYILTAAHCVHGLQNDLYEIRLGEHRISTEEDCRQ 190


>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Length = 278 Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Length = 289 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Length = 235 Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Length = 394 Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Length = 224 Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Length = 218 Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Length = 283 Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Length = 238 Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Length = 372 Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Length = 235 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Length = 329 Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Length = 254 Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Length = 235 Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Length = 225 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Length = 241 Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 242 Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Length = 259 Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Length = 224 Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Length = 240 Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Length = 228 Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Length = 250 Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Length = 248 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Length = 232 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Length = 222 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Length = 221 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Length = 240 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Length = 247 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Length = 251 Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Length = 252 Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Length = 226 Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 1bqy_A* Length = 234 Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Length = 242 Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_B Length = 251 Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Length = 240 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Length = 228 Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} PDB: 3bn9_B* 3nps_A 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Length = 241 Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Length = 241 Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Length = 261 Back     alignment and structure
>2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A Length = 80 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Length = 247 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Length = 238 Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Length = 223 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Length = 223 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Length = 234 Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Length = 225 Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Length = 224 Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Length = 245 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} Length = 228 Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Length = 238 Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Length = 245 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Length = 230 Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Length = 237 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Length = 227 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Length = 240 Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Length = 227 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Length = 238 Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Length = 237 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Length = 224 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Length = 234 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Length = 231 Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Length = 290 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Length = 131 Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Length = 224 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Length = 227 Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Length = 226 Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Length = 236 Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} PDB: 3g01_A Length = 227 Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Length = 240 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Length = 222 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Length = 235 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Length = 223 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Length = 240 Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Length = 234 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Length = 218 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query124
2pka_A80 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 99.93
2vnt_A 276 Urokinase-type plasminogen activator; UPA, inhibit 99.9
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 99.89
1yc0_A 283 Hepatocyte growth factor activator; hydrolase/inhi 99.88
2olg_A 278 Pro-phenoloxidase activating enzyme-I; prophenolox 99.88
2xxl_A 408 GRAM-positive specific serine protease, isoform B; 99.87
2bdy_A 289 Thrombin; thrombin, complex structure, hydrolase, 99.87
1mza_A 240 Pro-granzyme K; apoptosis, serine protease, S1 fam 99.87
2b9l_A 394 Prophenoloxidase activating factor; CLIP domain, e 99.87
2xw9_A 228 Complement factor D; immune system, hydrolase, ser 99.87
4f4o_C 347 Haptoglobin; globin fold, serine protease fold, co 99.87
1pq7_A 224 Trypsin; ultra-high resolution, catalysis, hydrola 99.86
1eq9_A 222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 99.86
2jde_A 276 Urokinase-type plasminogen activator; plasminogen 99.86
2bz6_H 254 Blood coagulation factor VIIA; serine protease, en 99.86
1t8o_A 245 Chymotrypsin A; chymotrypsin, serine proteinase, B 99.86
1md8_A 329 C1R complement serine protease; innate immunity, a 99.86
1zjk_A 403 Mannan-binding lectin serine protease 2; beta barr 99.86
3nxp_A 424 Prethrombin-1; allostery, blood coagulation, hydro 99.86
1z8g_A 372 Serine protease hepsin; serine protease hepsin, pr 99.85
2zgc_A 240 Granzyme M; serine protease, cytolysis, glycoprote 99.85
1pyt_D 251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 99.85
1ym0_A 238 Fibrinotic enzyme component B; two chains, glycosy 99.85
3gyl_B 261 Prostasin; ENAC, zymogen, divalent cation, channel 99.85
3gov_B 251 MAsp-1; complement, serine protease, beta barrel, 99.85
1azz_A 226 Collagenase; complex (serine protease/inhibitor), 99.85
1orf_A 234 Granzyme A; hydrolase-hydrolase inhibitor complex; 99.85
1lo6_A 223 Kallikrein 6, HK6; serine protease, human kallikre 99.84
1gpz_A 399 Complement C1R component; hydrolase, activation, i 99.84
1spj_A 238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 99.84
1ao5_A 237 Glandular kallikrein-13; serine protease, protein 99.84
1gvk_B 240 Elastase 1, peptide inhibitor; hydrolase, serine p 99.84
1elv_A 333 Complement C1S component; trypsin-like serin prote 99.84
2wph_S 235 Coagulation factor IXA heavy chain; serine proteas 99.84
3bg8_A 238 Coagulation factor XIA light chain; protease inhib 99.84
1gvz_A 237 Kallikrein-1E2; antigen, prostate specific antigen 99.84
1aut_C 250 Activated protein C; serine proteinase, plasma cal 99.84
2f91_A 237 Hepatopancreas trypsin; trypsin, canonical inhibit 99.84
1fxy_A 228 Coagulation factor XA-trypsin chimera; protease, c 99.84
2oq5_A 232 Transmembrane protease, serine 11E; type II trans- 99.84
1bru_P 241 Elastase, PPE; serine protease, hydrolase; HET: 1N 99.84
1npm_A 225 Neuropsin; serine proteinase, glycoprotein; HET: N 99.83
2jkh_A 241 Activated factor XA heavy chain; plasma, calcium, 99.83
2zch_P 237 Prostate-specific antigen; human PSA, kallikrein r 99.83
3ncl_A 241 Suppressor of tumorigenicity 14 protein; proteinas 99.83
2any_A 241 Kininogenin, plasma kallikrein, light chain, fletc 99.83
1sgf_A 240 7S NGF, nerve growth factor; growth factor (beta-N 99.83
2r0l_A 248 Hepatocyte growth factor activator; serine proteas 99.83
2f9n_A 245 Alpha I tryptase; serine proteinase, trypsin-like, 99.83
4dgj_A 235 Enteropeptidase catalytic light chain; serine prot 99.83
3mfj_A 223 Cationic trypsin; serine proteinase, hydrolase; 0. 99.83
1m9u_A 241 Earthworm fibrinolytic enzyme; hydrolase, serine p 99.83
1cgh_A 224 Cathepsin G; inflammation, specificity, serine pro 99.83
1iau_A 227 Granzyme B; hydrolase-hydrolase inhibitor complex; 99.83
2z7f_E 218 Leukocyte elastase; serine protease, serine protea 99.83
1rtf_B 252 (TC)-T-PA, two chain tissue plasminogen activator; 99.83
1euf_A 227 Duodenase; serine protease, dual specificity, hydr 99.83
2hlc_A 230 Collagenase; serine protease, hydrolase, collagen 99.83
2bdg_A 223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 99.83
1elt_A 236 Elastase; serine proteinase; 1.61A {Salmo salar} S 99.83
3mhw_U 247 Urokinase-type plasminogen activator; hydrolase, b 99.83
1fiw_A 290 Beta-acrosin heavy chain; anti-parallel beta-barre 99.83
1hj8_A 222 Trypsin I; hydrolase, radiation damage, disulphide 99.83
3f1s_B 283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 99.83
1ddj_A 247 Plasminogen; catalytic domain, blood clotting; 2.0 99.83
2psx_A 227 Kallikrein-5; zinc inhibition, stratum corneum, gl 99.83
4ag1_A 226 Chymase; hydrolase-de novo protein complex, inhibi 99.83
2qxi_A 224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 99.83
2xrc_A 565 Human complement factor I; immune system, hydrolas 99.83
3h7t_A 235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 99.83
3tvj_B 242 Mannan-binding lectin serine protease 2 B chain; i 99.82
3rp2_A 224 RAT MAST cell protease II; serine proteinase; 1.90 99.82
1a7s_A 225 Heparin binding protein; serine protease homolog, 99.82
3fzz_A 227 Granzyme C; hydrolase, cytolysis, protease, serine 99.82
3rm2_H 259 Thrombin heavy chain; serine protease, kringle, hy 99.82
2f83_A 625 Coagulation factor XI; protease, apple domain, hyd 99.82
4i8h_A 223 Cationic trypsin, beta-trypsin; serine protease, h 99.82
1ton_A 235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 99.82
2qy0_B 242 Complement C1R subcomponent; serine protease, beta 99.81
1fuj_A 221 PR3, myeloblastin; hydrolase, serine protease, gly 99.81
3beu_A 224 Trypsin, SGT; beta sheets, serine protease, hydrol 99.8
3s69_A 234 Thrombin-like enzyme defibrase; beta-barrel, serin 99.8
1fon_A 240 Procarboxypeptidase A-S6; truncated zymogen E, ser 99.79
2aiq_A 231 Protein C activator; snake venom serine proteinase 99.79
3s9c_A 234 Vipera russelli proteinase RVV-V gamma; serine pro 99.79
4e7n_A 238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 99.79
1si5_H 240 Scatter factor, hepatocyte growth factor, SF, hepa 99.79
2odp_A 509 Complement C2; C3/C5 convertase, complement serin 99.78
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 99.78
4dur_A 791 Plasminogen, serine protease; fibrinolysis, hydrol 99.76
2asu_B 234 Hepatocyte growth factor-like protein; serine prot 99.76
3h7o_A 228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 99.76
1rrk_A 497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 99.73
3hrz_D 741 Complement factor B; serine protease, glycosilated 99.67
1p3c_A 215 Glutamyl-endopeptidase; serine protease, hydrolase 99.62
3cp7_A 218 Alkaline serine protease Al20; trypsin-like, hydro 99.6
1qtf_A 246 Exfoliative toxin B; serine protease, superantigen 99.29
1agj_A 242 Epidermolytic toxin A; hydrolase, serine protease; 99.28
1wcz_A 268 Glutamyl endopeptidase; virulence factor, hydrolas 99.18
2o8l_A 274 V8 protease, taphylococcal serine; serine protease 99.15
2w7s_A 200 Serine protease SPLA; hydrolase, family S1; 1.80A 99.01
1arb_A 268 Achromobacter protease I; hydrolase(serine proteas 99.01
2vid_A 204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 98.97
2as9_A 210 Serine protease; trypsin-like fold, hydrolase; 1.7 98.79
3k6y_A 237 Serine protease, possible membrane-associated seri 98.19
1y8t_A 324 Hypothetical protein RV0983; serine protease, stru 97.8
3tjo_A 231 Serine protease HTRA1; peptidase, hydrolase; HET: 97.63
3num_A 332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.36
1l1j_A 239 Heat shock protease HTRA; hydrolase, serine protei 97.24
3lgi_A 237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 97.08
1te0_A 318 Protease DEGS; two domains, serine protease, PDZ, 97.04
1lcy_A 325 HTRA2 serine protease; apoptosis, PDZ domain, casp 96.94
3sti_A 245 Protease DEGQ; serine protease, PDZ domain, chaper 96.58
2sga_A 181 Proteinase A; hydrolase (serine proteinase); 1.50A 96.11
3qo6_A 348 Protease DO-like 1, chloroplastic; protease, HTRA, 96.08
3stj_A 345 Protease DEGQ; serine protease, PDZ domain, protea 95.82
2qa9_E 185 Streptogrisin-B; chymotrypsin-type serine peptidas 95.06
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 94.61
1zyo_A 191 Serine protease; beta-barrel, glutamyl endopeptida 92.97
2w5e_A163 Putative serine protease; coiled coil, transmembra 92.65
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 92.63
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 89.72
2ea3_A 189 Chymotrypsin; celloulomonas, protease, hydrolase; 88.28
1hpg_A 187 Glutamic acid specific protease; serine protease, 81.17
2h5c_A 198 Alpha-lytic protease; serine protease, acylation t 80.55
>2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A Back     alignment and structure
Probab=99.93  E-value=9.5e-26  Score=133.67  Aligned_cols=74  Identities=30%  Similarity=0.559  Sum_probs=62.8

Q ss_pred             eeCCEEcCCCCCceEEEEEeCCceeEEEEEecCCEEEecccccCCCCCceEEEEEceeecCCCCC------eecEEECCC
Q psy12894         47 IVGGNVTKLHEFPWIAALTKKGKFYCGATLIAKRHVLTAAHCIEGVNPKEIKVTLGEHDRLSKNE------SVPVIIHFS  120 (124)
Q Consensus        47 i~gg~~~~~~~~Pw~v~l~~~~~~~CgGsLi~~~~vlTaahC~~~~~~~~~~V~~G~~~~~~~~~------~~~vi~Hp~  120 (124)
                      |+||..+.+++|||++++...+.++|||+||+++||||||||+..    .+.|++|.+++.....      ..++++||+
T Consensus         1 IvgG~~a~~~~~Pw~v~l~~~~~~~CgGslIs~~~VLTAAHC~~~----~~~v~~G~~~~~~~~~~~~~~~v~~i~~Hp~   76 (80)
T 2pka_A            1 IIGGRECEKNSHPWQVAIYHYSSFQCGGVLVNPKWVLTAAHCKND----NYEVWLGRHNLFENENTAQFFGVTADFPHPG   76 (80)
T ss_dssp             CBSCEECCTTSCTTEEEEEETTEEEEEEEEEETTEEEECGGGCCS----CCEEEESCSBTTSCCTTCEEEEEEEEEECTT
T ss_pred             CCCCEECCCCCCCcEEEEEECCceEEEEEEEcCCEEEECHHHCCC----CcEEEEeeeEcCCCCCCcEEEEEEEEEECcC
Confidence            689999999999999999888889999999999999999999863    4579999988654322      335999999


Q ss_pred             CCCC
Q psy12894        121 VSNT  124 (124)
Q Consensus       121 y~~~  124 (124)
                      |+..
T Consensus        77 y~~~   80 (80)
T 2pka_A           77 FNLS   80 (80)
T ss_dssp             TTTC
T ss_pred             CCCC
Confidence            9863



>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 124
d1mzaa_ 240 b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [Ta 8e-20
d2bz6h1 254 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human 6e-19
d1rfna_ 235 b.47.1.2 (A:) Coagulation factor IXa, protease dom 8e-18
d1z8ga1 255 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Hum 8e-18
d1bioa_ 228 b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxI 2e-17
d1azza_ 226 b.47.1.2 (A:) Crab collagenase {Atlantic sand fidd 2e-17
d1ekbb_ 235 b.47.1.2 (B:) Enteropeptidase (enterokinase light 2e-17
d1gdna_ 224 b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxyspo 3e-17
d1gvza_ 237 b.47.1.2 (A:) Prostate specific antigen (PSA kalli 3e-17
d1op0a_ 234 b.47.1.2 (A:) Venom serine protease {Hundred-pace 4e-17
d1orfa_ 232 b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [Ta 4e-17
d1lo6a_ 221 b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [ 4e-17
d2z7fe1 218 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) 5e-17
d1eq9a_ 222 b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Re 5e-17
g2pka.1 232 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [T 5e-17
d1a7sa_ 225 b.47.1.2 (A:) Heparin binding protein, HBP {Human 6e-17
g1fiw.1 274 b.47.1.2 (L:,A:) Beta-acrosin {Sheep (Ovis aries) 7e-17
d1si5h_ 234 b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human 1e-16
d1ao5a_ 237 b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) 1e-16
d1rjxb_ 247 b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Hum 2e-16
d1npma_ 225 b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [Tax 2e-16
g1rtf.1 260 b.47.1.2 (A:,B:) Two-chain tissue plasminogen acti 3e-16
d1autc_ 240 b.47.1.2 (C:) Activated protein c (autoprothrombin 5e-16
d1q3xa1 242 b.47.1.2 (A:445-686) Mannan-binding lectin serine 7e-16
g1h8d.1 289 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [T 9e-16
d2fpza1 243 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sap 1e-15
d1m9ua_ 241 b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [Tax 2e-15
d2p3ub1 233 b.47.1.2 (B:16-243) Coagulation factor Xa, proteas 2e-15
g1gj7.1 256 b.47.1.2 (A:,B:) Urokinase-type plasminogen activa 2e-15
d1j16a_ 223 b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicu 2e-15
d1xx9a_ 237 b.47.1.2 (A:) Coagulation factor XI {Human (Homo s 3e-15
d1eaxa_ 241 b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapien 3e-15
d2qy0b1 240 b.47.1.2 (B:447-686) Complement C1R protease, cata 4e-15
d1elta_ 236 b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxI 4e-15
d1tona_ 235 b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 1 5e-15
d1hj8a_ 222 b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon 5e-15
d1rrka1 287 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens 6e-15
d1fxya_ 228 b.47.1.2 (A:) Coagulation factor Xa-trypsin chimer 7e-15
d1os8a_ 223 b.47.1.1 (A:) Trypsin {Streptomyces griseus, strai 8e-15
d1hj9a_ 223 b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [Tax 8e-15
g1gg6.1 238 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(oge 1e-14
d1elva1 259 b.47.1.2 (A:410-668) Complement C1S protease, cata 1e-14
d1brup_ 241 b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9 9e-14
d1fq3a_ 227 b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [Ta 9e-14
d1gvkb_ 240 b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9 1e-13
d1sgfa_ 228 b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus 1e-13
d2f91a1 237 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed c 1e-13
d1fuja_ 221 b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapie 1e-13
d1nn6a_ 224 b.47.1.2 (A:) Chymase (mast cell protease I) {Huma 2e-13
d3rp2a_ 224 b.47.1.2 (A:) Chymase II (mast cell proteinase II) 5e-13
d1t32a1 224 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapie 8e-13
d2hlca_ 230 b.47.1.2 (A:) HL collagenase {Common cattle grub ( 1e-12
d1eufa_ 224 b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 2e-12
d1fi8a_ 227 b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) 3e-12
d1pytd_ 251 b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Co 1e-11
d1fona_ 232 b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III 3e-11
d1p3ca_ 215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 2e-09
d2o8la1 216 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur 2e-06
d1arba_ 263 b.47.1.1 (A:) Achromobacter protease {Achromobacte 3e-06
d1agja_ 242 b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A 3e-05
d1qtfa_ 246 b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus 3e-04
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure

class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Eukaryotic proteases
domain: Granzyme K
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 79.3 bits (194), Expect = 8e-20
 Identities = 23/75 (30%), Positives = 33/75 (44%)

Query: 46  RIVGGNVTKLHEFPWIAALTKKGKFYCGATLIAKRHVLTAAHCIEGVNPKEIKVTLGEHD 105
            I+GG     H  P++A++   G   CG  LI  + VLTAAHC       +    +    
Sbjct: 2   EIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAH 61

Query: 106 RLSKNESVPVIIHFS 120
            LSKNE+    +   
Sbjct: 62  SLSKNEASKQTLEIK 76


>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 235 Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 255 Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Length = 226 Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Length = 235 Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Length = 224 Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Length = 237 Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Length = 234 Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Length = 222 Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Length = 225 Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Length = 234 Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Length = 237 Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Length = 225 Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Length = 241 Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 223 Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Length = 237 Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 241 Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Length = 236 Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Length = 235 Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Length = 222 Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 287 Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Length = 228 Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 223 Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 223 Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 259 Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 241 Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Length = 227 Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 240 Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Length = 228 Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Length = 237 Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Length = 224 Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Length = 230 Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Length = 224 Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 227 Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 251 Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Length = 232 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Length = 263 Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query124
g1fiw.1 274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 99.86
g1rtf.1 260 Two-chain tissue plasminogen activator (TC)-T-PA { 99.85
g1gj7.1 256 Urokinase-type plasminogen activator (LMW U-PA), c 99.84
d1mzaa_ 240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1bioa_ 228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1lo6a_ 221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1a7sa_ 225 Heparin binding protein, HBP {Human (Homo sapiens) 99.82
d1azza_ 226 Crab collagenase {Atlantic sand fiddler crab (Uca 99.81
d2hlca_ 230 HL collagenase {Common cattle grub (Hypoderma line 99.81
d2z7fe1 218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 99.81
g1gg6.1 238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.8
d1ao5a_ 237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 99.8
d1orfa_ 232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1autc_ 240 Activated protein c (autoprothrombin IIa) {Human ( 99.8
d1q3xa1 242 Mannan-binding lectin serine protease 2 (MASP-2), 99.8
d1gdna_ 224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 99.8
d1fuja_ 221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 99.79
d1m9ua_ 241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 99.79
g1h8d.1 289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1ekbb_ 235 Enteropeptidase (enterokinase light chain) {Cow (B 99.79
d1nn6a_ 224 Chymase (mast cell protease I) {Human (Homo sapien 99.79
d2bz6h1 254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 99.78
d1fi8a_ 227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 99.78
d1eq9a_ 222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 99.78
d1eaxa_ 241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 99.78
d2p3ub1 233 Coagulation factor Xa, protease domain {Human (Hom 99.78
d2qy0b1 240 Complement C1R protease, catalytic domain {Human ( 99.78
d1rfna_ 235 Coagulation factor IXa, protease domain {Human (Ho 99.77
d1elva1 259 Complement C1S protease, catalytic domain {Human ( 99.77
d3rp2a_ 224 Chymase II (mast cell proteinase II) {Rat (Rattus 99.77
d1eufa_ 224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 99.77
d1pytd_ 251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.76
d1si5h_ 234 Hepatocyte growth factor, HGF {Human (Homo sapiens 99.76
d1rjxb_ 247 Plasmin(ogen), catalytic domain {Human (Homo sapie 99.76
d2fpza1 243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1fq3a_ 227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1os8a_ 223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 99.76
d2f91a1 237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 99.75
d1j16a_ 223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 99.75
d1t32a1 224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1hj9a_ 223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 99.75
d1xx9a_ 237 Coagulation factor XI {Human (Homo sapiens) [TaxId 99.74
d1rrka1 287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1fxya_ 228 Coagulation factor Xa-trypsin chimera {Synthetic, 99.73
d1npma_ 225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 99.73
d1op0a_ 234 Venom serine protease {Hundred-pace snake (Agkistr 99.73
d1hj8a_ 222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 99.72
d1z8ga1 255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 99.71
d1brup_ 241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.71
d1gvza_ 237 Prostate specific antigen (PSA kallikrein) {Horse 99.71
d1gvkb_ 240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.7
d1elta_ 236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 99.7
g2pka.1 232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 99.69
d1tona_ 235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 99.68
d1fona_ 232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 99.64
d1sgfa_ 228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 99.53
d1arba_ 263 Achromobacter protease {Achromobacter lyticus, str 99.2
d1p3ca_ 215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 99.02
d1agja_ 242 Epidermolytic (exfoliative) toxin A {Staphylococcu 98.18
d2o8la1 216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 98.08
d1qtfa_ 246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 97.75
d1hpga_ 187 Glutamic acid-specific protease {Streptomyces gris 96.99
d2qaaa1 185 Protease B {Streptomyces griseus, strain k1 [TaxId 90.26
d2sgaa_ 181 Protease A {Streptomyces griseus, strain k1 [TaxId 87.85
d1lcya2 205 Mitochondrial serine protease HtrA2, catalytic dom 86.9
d2h5ca1 198 alpha-Lytic protease {Lysobacter enzymogenes, 495 85.93
d2z9ia2 221 Protease PepD {Mycobacterium tuberculosis [TaxId: 84.47
d2qf3a1 210 Stress sensor protease DegS, catalytic domain {Esc 82.33
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure