Diaphorina citri psyllid: psy12917


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MEKLTFYALSSPEKLDRIGEYLYQRASRDISRRRNGYVVIAMEAMDQLLAACHSQTLNLFVESFLKIVQKLLESLDPDLQILATNSFVRFANIEEDTPSYHRRYDFFVSKFSALCHSNYADVTKRNKLRLAGIRGIQGVIRKTVSDDLVENIWESTHMEKIIPSLLFNMQESGHYQSPADPEPEAEETGKMMNLQVPT
ccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccccccHHHHHHHHHcccccccccccccccccHHccccccccccc
MEKLTFYALSSPEKLDRIGEYLYQRASRDISRRRNGYVVIAMEAMDQLLAACHSQTLNLFVESFLKIVQKLLESLDPDLQILATNSFVRFANIEEDTPSYHRRYDFFVSKFSALCHSNYADVTKRNKLRLAGIRGIQGVIRKTVSDDLVENIWESTHMEKIIPSLLFNM*****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKLTFYALSSPEKLDRIGEYLYQRASRDISRRRNGYVVIAMEAMDQLLAACHSQTLNLFVESFLKIVQKLLESLDPDLQILATNSFVRFANIEEDTPSYHRRYDFFVSKFSALCHSNYADVTKRNKLRLAGIRGIQGVIRKTVSDDLVENIWESTHMEKIIPSLLFNMQESGHYQSPADPEPEAEETGKMMNLQVPT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein EFR3 homolog cmp44E An essential gene required for embryogenesis; required for cell viability.confidentQ8IGJ0
Protein EFR3 homolog A confidentQ14156
Protein EFR3 homolog B confidentQ5SPP5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045202 [CC]synapseprobableGO:0005575
GO:0007602 [BP]phototransductionprobableGO:0044700, GO:0051716, GO:0009583, GO:0051606, GO:0009605, GO:0009581, GO:0009314, GO:0050896, GO:0009987, GO:0044763, GO:0009582, GO:0050794, GO:0008150, GO:0065007, GO:0009416, GO:0007165, GO:0023052, GO:0007154, GO:0009628, GO:0050789, GO:0044699
GO:0000910 [BP]cytokinesisprobableGO:0009987, GO:0008150, GO:0044763, GO:0007049, GO:0051301, GO:0022402, GO:0044699
GO:0016079 [BP]synaptic vesicle exocytosisprobableGO:0019226, GO:0003001, GO:0035637, GO:0051648, GO:0007268, GO:0032940, GO:0032501, GO:0023052, GO:0001505, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0006887, GO:0065007, GO:0051640, GO:0097479, GO:0065008, GO:0009987, GO:0050877, GO:0003008, GO:0006810, GO:0023061, GO:0044765, GO:0044763, GO:0007269, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0097480, GO:0051641, GO:0044700, GO:0046903, GO:0016192, GO:0044707, GO:0008150, GO:0006836
GO:0005622 [CC]intracellularprobableGO:0005575, GO:0044464, GO:0005623
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0030100 [BP]regulation of endocytosisprobableGO:0051049, GO:0051128, GO:0060627, GO:0065007, GO:0008150, GO:0032879, GO:0050789, GO:0050794

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FDD, chain A
Confidence level:probable
Coverage over the Query: 31-171
View the alignment between query and template
View the model in PyMOL