Diaphorina citri psyllid: psy12925


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80---
MCLVTDEDWSLIPKQNKLSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLEVIDY
ccCCccccccccccccccEEEEEEccHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHcccccc
*CLVTDEDWSLIPKQNKLSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLEVIDY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCLVTDEDWSLIPKQNKLSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLEVIDY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sorting nexin-4 May be involved in several stages of intracellular trafficking. Plays a role in recycling endocytosed transferrin receptor and prevent its degradation.confidentO95219
Sorting nexin-4 May be involved in several stages of intracellular trafficking. Plays a role in recycling endocytosed transferrin receptor and prevent its degradation.confidentA1A4L0
Sorting nexin-4 May be involved in several stages of intracellular trafficking. Plays a role in recycling endocytosed transferrin receptor and prevent its degradation.confidentQ91YJ2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031901 [CC]early endosome membraneprobableGO:0005737, GO:0005575, GO:0043226, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0005769, GO:0044422, GO:0010008
GO:0035091 [MF]phosphatidylinositol bindingprobableGO:0043168, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488
GO:0005868 [CC]cytoplasmic dynein complexprobableGO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0043226, GO:0044424, GO:0030286, GO:0043228, GO:0005875, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IQ2, chain A
Confidence level:very confident
Coverage over the Query: 9-83
View the alignment between query and template
View the model in PyMOL