Psyllid ID: psy12925
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 83 | ||||||
| 357611857 | 419 | putative Sorting nexin 4 [Danaus plexipp | 0.843 | 0.167 | 0.526 | 3e-17 | |
| 189234487 | 417 | PREDICTED: similar to sorting nexin 4 [T | 0.734 | 0.146 | 0.634 | 7e-17 | |
| 270001727 | 415 | hypothetical protein TcasGA2_TC000603 [T | 0.734 | 0.146 | 0.634 | 7e-17 | |
| 242015880 | 421 | Sorting nexin-4, putative [Pediculus hum | 0.734 | 0.144 | 0.650 | 2e-16 | |
| 383856120 | 416 | PREDICTED: sorting nexin-4-like [Megachi | 0.734 | 0.146 | 0.571 | 1e-15 | |
| 307180190 | 422 | Sorting nexin-4 [Camponotus floridanus] | 0.867 | 0.170 | 0.526 | 4e-15 | |
| 332016453 | 416 | Sorting nexin-4 [Acromyrmex echinatior] | 0.867 | 0.173 | 0.526 | 6e-15 | |
| 307209903 | 421 | Sorting nexin-4 [Harpegnathos saltator] | 0.843 | 0.166 | 0.538 | 6e-15 | |
| 322793257 | 380 | hypothetical protein SINV_14846 [Solenop | 0.746 | 0.163 | 0.562 | 8e-15 | |
| 348524588 | 476 | PREDICTED: sorting nexin-4-like [Oreochr | 0.686 | 0.119 | 0.610 | 8e-15 |
| >gi|357611857|gb|EHJ67683.1| putative Sorting nexin 4 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
Score = 92.0 bits (227), Expect = 3e-17, Method: Compositional matrix adjust.
Identities = 40/76 (52%), Positives = 61/76 (80%), Gaps = 6/76 (7%)
Query: 4 VTDEDWSLIPKQNKLSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAAST 63
VTD +++++ Q+K+S +WRRY+EFEQ+ +YLQ TYP+V++PPLPEK+ + W+ +
Sbjct: 63 VTDPEYNIV--QSKISTIWRRYTEFEQIHDYLQVTYPHVVIPPLPEKRVLYAWR----KS 116
Query: 64 DITDPDFVDRRRASLE 79
D TDP+FV+RRRA+LE
Sbjct: 117 DTTDPEFVERRRAALE 132
|
Source: Danaus plexippus Species: Danaus plexippus Genus: Danaus Family: Nymphalidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|189234487|ref|XP_970429.2| PREDICTED: similar to sorting nexin 4 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270001727|gb|EEZ98174.1| hypothetical protein TcasGA2_TC000603 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242015880|ref|XP_002428575.1| Sorting nexin-4, putative [Pediculus humanus corporis] gi|212513209|gb|EEB15837.1| Sorting nexin-4, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|383856120|ref|XP_003703558.1| PREDICTED: sorting nexin-4-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307180190|gb|EFN68223.1| Sorting nexin-4 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332016453|gb|EGI57366.1| Sorting nexin-4 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307209903|gb|EFN86682.1| Sorting nexin-4 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|322793257|gb|EFZ16914.1| hypothetical protein SINV_14846 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|348524588|ref|XP_003449805.1| PREDICTED: sorting nexin-4-like [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 83 | ||||||
| ZFIN|ZDB-GENE-030131-1923 | 434 | snx4 "sorting nexin 4" [Danio | 0.686 | 0.131 | 0.627 | 1.8e-15 | |
| UNIPROTKB|E1BQF6 | 402 | SNX4 "Uncharacterized protein" | 0.686 | 0.141 | 0.610 | 3.1e-15 | |
| UNIPROTKB|F1PPA2 | 403 | SNX4 "Uncharacterized protein" | 0.686 | 0.141 | 0.610 | 1.4e-14 | |
| UNIPROTKB|F8W9T3 | 155 | SNX4 "Sorting nexin-4" [Homo s | 0.686 | 0.367 | 0.576 | 1.4e-14 | |
| MGI|MGI:1916400 | 450 | Snx4 "sorting nexin 4" [Mus mu | 0.686 | 0.126 | 0.610 | 1.5e-14 | |
| RGD|1309763 | 450 | Snx4 "sorting nexin 4" [Rattus | 0.686 | 0.126 | 0.610 | 1.9e-14 | |
| UNIPROTKB|A1A4L0 | 450 | SNX4 "Sorting nexin-4" [Bos ta | 0.686 | 0.126 | 0.593 | 2.4e-14 | |
| UNIPROTKB|O95219 | 450 | SNX4 "Sorting nexin-4" [Homo s | 0.686 | 0.126 | 0.576 | 8.5e-14 | |
| UNIPROTKB|Q5R4C2 | 450 | SNX4 "Sorting nexin-4" [Pongo | 0.686 | 0.126 | 0.576 | 8.5e-14 | |
| POMBASE|SPCC16A11.08 | 534 | atg20 "sorting nexin Atg20 (pr | 0.903 | 0.140 | 0.325 | 1.9e-05 |
| ZFIN|ZDB-GENE-030131-1923 snx4 "sorting nexin 4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 201 (75.8 bits), Expect = 1.8e-15, P = 1.8e-15
Identities = 37/59 (62%), Positives = 45/59 (76%)
Query: 21 VWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLE 79
+WRRYSEFE ++NYL TYP+V++PPLPEK+ FVW H S D DPDFV+RRR LE
Sbjct: 87 LWRRYSEFELLRNYLLVTYPFVVVPPLPEKRAEFVW-HKL-SADNMDPDFVERRRVGLE 143
|
|
| UNIPROTKB|E1BQF6 SNX4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PPA2 SNX4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8W9T3 SNX4 "Sorting nexin-4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1916400 Snx4 "sorting nexin 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1309763 Snx4 "sorting nexin 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A1A4L0 SNX4 "Sorting nexin-4" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O95219 SNX4 "Sorting nexin-4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R4C2 SNX4 "Sorting nexin-4" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPCC16A11.08 atg20 "sorting nexin Atg20 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 83 | |||
| cd06864 | 129 | cd06864, PX_SNX4, The phosphoinositide binding Pho | 1e-30 | |
| cd06093 | 106 | cd06093, PX_domain, The Phox Homology domain, a ph | 1e-12 | |
| cd06859 | 114 | cd06859, PX_SNX1_2_like, The phosphoinositide bind | 1e-11 | |
| smart00312 | 105 | smart00312, PX, PhoX homologous domain, present in | 4e-11 | |
| pfam00787 | 109 | pfam00787, PX, PX domain | 5e-11 | |
| cd06867 | 112 | cd06867, PX_SNX41_42, The phosphoinositide binding | 3e-09 | |
| cd06866 | 105 | cd06866, PX_SNX8_Mvp1p_like, The phosphoinositide | 4e-08 | |
| cd06898 | 113 | cd06898, PX_SNX10, The phosphoinositide binding Ph | 1e-07 | |
| cd06861 | 112 | cd06861, PX_Vps5p, The phosphoinositide binding Ph | 6e-07 | |
| cd06876 | 133 | cd06876, PX_MDM1p, The phosphoinositide binding Ph | 2e-06 | |
| COG5391 | 524 | COG5391, COG5391, Phox homology (PX) domain protei | 3e-06 | |
| cd07282 | 124 | cd07282, PX_SNX2, The phosphoinositide binding Pho | 3e-06 | |
| cd06865 | 120 | cd06865, PX_SNX_like, The phosphoinositide binding | 5e-06 | |
| cd06860 | 116 | cd06860, PX_SNX7_30_like, The phosphoinositide bin | 5e-06 | |
| cd06894 | 123 | cd06894, PX_SNX3_like, The phosphoinositide bindin | 9e-06 | |
| cd07280 | 120 | cd07280, PX_YPT35, The phosphoinositide binding Ph | 9e-06 | |
| cd06863 | 118 | cd06863, PX_Atg24p, The phosphoinositide binding P | 2e-05 | |
| cd06868 | 120 | cd06868, PX_HS1BP3, The phosphoinositide binding P | 3e-05 | |
| cd07294 | 132 | cd07294, PX_SNX12, The phosphoinositide binding Ph | 3e-05 | |
| cd06897 | 108 | cd06897, PX_SNARE, The phosphoinositide binding Ph | 7e-05 | |
| cd07284 | 116 | cd07284, PX_SNX7, The phosphoinositide binding Pho | 9e-05 | |
| cd07283 | 116 | cd07283, PX_SNX30, The phosphoinositide binding Ph | 3e-04 | |
| cd06883 | 109 | cd06883, PX_PI3K_C2, The phosphoinositide binding | 4e-04 | |
| cd07295 | 116 | cd07295, PX_Grd19, The phosphoinositide binding Ph | 4e-04 | |
| cd07281 | 124 | cd07281, PX_SNX1, The phosphoinositide binding Pho | 7e-04 | |
| cd06862 | 125 | cd06862, PX_SNX9_18_like, The phosphoinositide bin | 0.001 | |
| cd06874 | 127 | cd06874, PX_KIF16B_SNX23, The phosphoinositide bin | 0.001 | |
| cd07293 | 123 | cd07293, PX_SNX3, The phosphoinositide binding Pho | 0.002 |
| >gnl|CDD|132774 cd06864, PX_SNX4, The phosphoinositide binding Phox Homology domain of Sorting Nexin 4 | Back alignment and domain information |
|---|
Score = 103 bits (260), Expect = 1e-30
Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
Query: 17 KLSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRA 76
KLS +WRRYSEFE ++NYL TYPYVI+PPLPEK+ F+W+ S+D DPDFV+RRRA
Sbjct: 44 KLSSLWRRYSEFELLRNYLVVTYPYVIVPPLPEKRAMFMWQK--LSSDTFDPDFVERRRA 101
Query: 77 SLE 79
LE
Sbjct: 102 GLE 104
|
The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. SNX4 is involved in recycling traffic from the sorting endosome (post-Golgi endosome) back to the late Golgi. It shows a similar domain architecture as SNX1-2, among others, containing a Bin/Amphiphysin/Rvs (BAR) domain, which detects membrane curvature, C-terminal to the PX domain. SNX4 is implicated in the regulation of plasma membrane receptor trafficking and interacts with receptors for EGF, insulin, platelet-derived growth factor and the long form of the leptin receptor. Length = 129 |
| >gnl|CDD|132768 cd06093, PX_domain, The Phox Homology domain, a phosphoinositide binding module | Back alignment and domain information |
|---|
| >gnl|CDD|132769 cd06859, PX_SNX1_2_like, The phosphoinositide binding Phox Homology domain of Sorting Nexins 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|214610 smart00312, PX, PhoX homologous domain, present in p47phox and p40phox | Back alignment and domain information |
|---|
| >gnl|CDD|216119 pfam00787, PX, PX domain | Back alignment and domain information |
|---|
| >gnl|CDD|132777 cd06867, PX_SNX41_42, The phosphoinositide binding Phox Homology domain of fungal Sorting Nexins 41 and 42 | Back alignment and domain information |
|---|
| >gnl|CDD|132776 cd06866, PX_SNX8_Mvp1p_like, The phosphoinositide binding Phox Homology domain of Sorting Nexin 8 and yeast Mvp1p | Back alignment and domain information |
|---|
| >gnl|CDD|132808 cd06898, PX_SNX10, The phosphoinositide binding Phox Homology domain of Sorting Nexin 10 | Back alignment and domain information |
|---|
| >gnl|CDD|132771 cd06861, PX_Vps5p, The phosphoinositide binding Phox Homology domain of yeast sorting nexin Vps5p | Back alignment and domain information |
|---|
| >gnl|CDD|132786 cd06876, PX_MDM1p, The phosphoinositide binding Phox Homology domain of yeast MDM1p | Back alignment and domain information |
|---|
| >gnl|CDD|227680 COG5391, COG5391, Phox homology (PX) domain protein [Intracellular trafficking and secretion / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|132815 cd07282, PX_SNX2, The phosphoinositide binding Phox Homology domain of Sorting Nexin 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132775 cd06865, PX_SNX_like, The phosphoinositide binding Phox Homology domain of SNX-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|132770 cd06860, PX_SNX7_30_like, The phosphoinositide binding Phox Homology domain of Sorting Nexins 7 and 30 | Back alignment and domain information |
|---|
| >gnl|CDD|132804 cd06894, PX_SNX3_like, The phosphoinositide binding Phox Homology domain of Sorting Nexin 3 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|132813 cd07280, PX_YPT35, The phosphoinositide binding Phox Homology domain of the fungal protein YPT35 | Back alignment and domain information |
|---|
| >gnl|CDD|132773 cd06863, PX_Atg24p, The phosphoinositide binding Phox Homology domain of yeast Atg24p, an autophagic degradation protein | Back alignment and domain information |
|---|
| >gnl|CDD|132778 cd06868, PX_HS1BP3, The phosphoinositide binding Phox Homology domain of HS1BP3 | Back alignment and domain information |
|---|
| >gnl|CDD|132827 cd07294, PX_SNX12, The phosphoinositide binding Phox Homology domain of Sorting Nexin 12 | Back alignment and domain information |
|---|
| >gnl|CDD|132807 cd06897, PX_SNARE, The phosphoinositide binding Phox Homology domain of SNARE proteins from fungi | Back alignment and domain information |
|---|
| >gnl|CDD|132817 cd07284, PX_SNX7, The phosphoinositide binding Phox Homology domain of Sorting Nexin 7 | Back alignment and domain information |
|---|
| >gnl|CDD|132816 cd07283, PX_SNX30, The phosphoinositide binding Phox Homology domain of Sorting Nexin 30 | Back alignment and domain information |
|---|
| >gnl|CDD|132793 cd06883, PX_PI3K_C2, The phosphoinositide binding Phox Homology Domain of Class II Phosphoinositide 3-Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132828 cd07295, PX_Grd19, The phosphoinositide binding Phox Homology domain of fungal Grd19 | Back alignment and domain information |
|---|
| >gnl|CDD|132814 cd07281, PX_SNX1, The phosphoinositide binding Phox Homology domain of Sorting Nexin 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132772 cd06862, PX_SNX9_18_like, The phosphoinositide binding Phox Homology domain of Sorting Nexins 9 and 18 | Back alignment and domain information |
|---|
| >gnl|CDD|132784 cd06874, PX_KIF16B_SNX23, The phosphoinositide binding Phox Homology domain of KIF16B kinesin or Sorting Nexin 23 | Back alignment and domain information |
|---|
| >gnl|CDD|132826 cd07293, PX_SNX3, The phosphoinositide binding Phox Homology domain of Sorting Nexin 3 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 83 | |||
| cd07283 | 116 | PX_SNX30 The phosphoinositide binding Phox Homolog | 99.89 | |
| cd07284 | 116 | PX_SNX7 The phosphoinositide binding Phox Homology | 99.89 | |
| cd07282 | 124 | PX_SNX2 The phosphoinositide binding Phox Homology | 99.88 | |
| cd07286 | 127 | PX_SNX18 The phosphoinositide binding Phox Homolog | 99.88 | |
| cd06864 | 129 | PX_SNX4 The phosphoinositide binding Phox Homology | 99.87 | |
| cd07293 | 123 | PX_SNX3 The phosphoinositide binding Phox Homology | 99.87 | |
| cd06860 | 116 | PX_SNX7_30_like The phosphoinositide binding Phox | 99.86 | |
| cd06863 | 118 | PX_Atg24p The phosphoinositide binding Phox Homolo | 99.86 | |
| cd06894 | 123 | PX_SNX3_like The phosphoinositide binding Phox Hom | 99.86 | |
| cd06861 | 112 | PX_Vps5p The phosphoinositide binding Phox Homolog | 99.85 | |
| cd07285 | 126 | PX_SNX9 The phosphoinositide binding Phox Homology | 99.85 | |
| cd07295 | 116 | PX_Grd19 The phosphoinositide binding Phox Homolog | 99.85 | |
| cd06865 | 120 | PX_SNX_like The phosphoinositide binding Phox Homo | 99.85 | |
| cd07294 | 132 | PX_SNX12 The phosphoinositide binding Phox Homolog | 99.85 | |
| cd07281 | 124 | PX_SNX1 The phosphoinositide binding Phox Homology | 99.85 | |
| cd06867 | 112 | PX_SNX41_42 The phosphoinositide binding Phox Homo | 99.84 | |
| cd06891 | 140 | PX_Vps17p The phosphoinositide binding Phox Homolo | 99.84 | |
| KOG2527|consensus | 144 | 99.83 | ||
| cd06868 | 120 | PX_HS1BP3 The phosphoinositide binding Phox Homolo | 99.83 | |
| cd06866 | 105 | PX_SNX8_Mvp1p_like The phosphoinositide binding Ph | 99.83 | |
| cd06898 | 113 | PX_SNX10 The phosphoinositide binding Phox Homolog | 99.83 | |
| cd07288 | 118 | PX_SNX15 The phosphoinositide binding Phox Homolog | 99.81 | |
| cd06892 | 141 | PX_SNX5_like The phosphoinositide binding Phox Hom | 99.81 | |
| cd06862 | 125 | PX_SNX9_18_like The phosphoinositide binding Phox | 99.8 | |
| cd07287 | 118 | PX_RPK118_like The phosphoinositide binding Phox H | 99.8 | |
| cd06881 | 117 | PX_SNX15_like The phosphoinositide binding Phox Ho | 99.8 | |
| cd06877 | 119 | PX_SNX14 The phosphoinositide binding Phox Homolog | 99.8 | |
| cd06859 | 114 | PX_SNX1_2_like The phosphoinositide binding Phox H | 99.79 | |
| cd07280 | 120 | PX_YPT35 The phosphoinositide binding Phox Homolog | 99.79 | |
| cd07292 | 141 | PX_SNX6 The phosphoinositide binding Phox Homology | 99.79 | |
| cd06879 | 138 | PX_UP1_plant The phosphoinositide binding Phox Hom | 99.78 | |
| cd07301 | 112 | PX_SNX21 The phosphoinositide binding Phox Homolog | 99.78 | |
| cd07276 | 110 | PX_SNX16 The phosphoinositide binding Phox Homolog | 99.77 | |
| cd06897 | 108 | PX_SNARE The phosphoinositide binding Phox Homolog | 99.77 | |
| cd07279 | 112 | PX_SNX20_21_like The phosphoinositide binding Phox | 99.77 | |
| cd07300 | 114 | PX_SNX20 The phosphoinositide binding Phox Homolog | 99.76 | |
| cd07291 | 141 | PX_SNX5 The phosphoinositide binding Phox Homology | 99.76 | |
| cd07277 | 118 | PX_RUN The phosphoinositide binding Phox Homology | 99.75 | |
| cd06872 | 107 | PX_SNX19_like_plant The phosphoinositide binding P | 99.74 | |
| cd06873 | 120 | PX_SNX13 The phosphoinositide binding Phox Homolog | 99.74 | |
| cd06870 | 109 | PX_CISK The phosphoinositide binding Phox Homology | 99.74 | |
| cd06886 | 106 | PX_SNX27 The phosphoinositide binding Phox Homolog | 99.74 | |
| cd06875 | 116 | PX_IRAS The phosphoinositide binding Phox Homology | 99.71 | |
| cd06893 | 132 | PX_SNX19 The phosphoinositide binding Phox Homolog | 99.71 | |
| cd06874 | 127 | PX_KIF16B_SNX23 The phosphoinositide binding Phox | 99.7 | |
| cd06876 | 133 | PX_MDM1p The phosphoinositide binding Phox Homolog | 99.7 | |
| smart00312 | 105 | PX PhoX homologous domain, present in p47phox and | 99.7 | |
| cd06878 | 127 | PX_SNX25 The phosphoinositide binding Phox Homolog | 99.69 | |
| cd06885 | 104 | PX_SNX17_31 The phosphoinositide binding Phox Homo | 99.69 | |
| cd06880 | 110 | PX_SNX22 The phosphoinositide binding Phox Homolog | 99.69 | |
| cd06883 | 109 | PX_PI3K_C2 The phosphoinositide binding Phox Homol | 99.67 | |
| cd06882 | 123 | PX_p40phox The phosphoinositide binding Phox Homol | 99.65 | |
| cd06871 | 120 | PX_MONaKA The phosphoinositide binding Phox Homolo | 99.64 | |
| cd06869 | 119 | PX_UP2_fungi The phosphoinositide binding Phox Hom | 99.62 | |
| cd06884 | 111 | PX_PI3K_C2_68D The phosphoinositide binding Phox H | 99.61 | |
| cd06093 | 106 | PX_domain The Phox Homology domain, a phosphoinosi | 99.61 | |
| KOG2273|consensus | 503 | 99.59 | ||
| PF00787 | 113 | PX: PX domain; InterPro: IPR001683 The PX (phox) d | 99.57 | |
| KOG2528|consensus | 490 | 99.55 | ||
| cd06887 | 118 | PX_p47phox The phosphoinositide binding Phox Homol | 99.52 | |
| COG5391 | 524 | Phox homology (PX) domain protein [Intracellular t | 99.5 | |
| cd06888 | 119 | PX_FISH The phosphoinositide binding Phox Homology | 99.47 | |
| cd07290 | 109 | PX_PI3K_C2_beta The phosphoinositide binding Phox | 99.46 | |
| cd07289 | 109 | PX_PI3K_C2_alpha The phosphoinositide binding Phox | 99.44 | |
| cd06890 | 112 | PX_Bem1p The phosphoinositide binding Phox Homolog | 99.43 | |
| cd06895 | 140 | PX_PLD The phosphoinositide binding Phox Homology | 99.39 | |
| cd07296 | 135 | PX_PLD1 The phosphoinositide binding Phox Homology | 99.17 | |
| KOG1259|consensus | 490 | 98.98 | ||
| cd06889 | 121 | PX_NoxO1 The phosphoinositide binding Phox Homolog | 98.86 | |
| cd06896 | 101 | PX_PI3K_C2_gamma The phosphoinositide binding Phox | 98.7 | |
| KOG2101|consensus | 362 | 98.2 | ||
| cd07297 | 130 | PX_PLD2 The phosphoinositide binding Phox Homology | 98.16 | |
| KOG3784|consensus | 407 | 97.96 | ||
| KOG0905|consensus | 1639 | 96.58 | ||
| KOG1660|consensus | 399 | 96.51 | ||
| KOG4773|consensus | 386 | 96.5 | ||
| cd07298 | 115 | PX_RICS The phosphoinositide binding Phox Homology | 95.36 |
| >cd07283 PX_SNX30 The phosphoinositide binding Phox Homology domain of Sorting Nexin 30 | Back alignment and domain information |
|---|
Probab=99.89 E-value=3.2e-23 Score=131.75 Aligned_cols=71 Identities=28% Similarity=0.388 Sum_probs=60.1
Q ss_pred ecccccCCCCC-ceeeecccchHHHHHHHHHHHCCCCCCCCCCCCCccccccccCCCCCCCCHHHHHHHHHHHHHhhC
Q psy12925 7 EDWSLIPKQNK-LSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLEVIDY 83 (83)
Q Consensus 7 ~~~~~~p~~~k-~~~V~RRYSdF~~L~~~L~~~~p~~~iPplP~K~~~~~~~~~~~~~~~~~~~fie~Rr~~Le~fL~ 83 (83)
+.-++.|.+.+ ++.|+||||||+||++.|...+|++++||||+|+.+... .++++++|||+||++||.||+
T Consensus 24 ~t~t~~~~~~~~~~~V~RRYsDF~~L~~~L~~~~p~~~iPpLP~K~~~~~~------~~~~~~~fie~Rr~~Le~FL~ 95 (116)
T cd07283 24 TTKTTRTEFDLPEYSVRRRYQDFDWLRNKLEESQPTHLIPPLPEKFVVKGV------VDRFSEEFVETRRKALDKFLK 95 (116)
T ss_pred EEecCCCCcccCceEEeCCccHHHHHHHHHHHhCCCcccCCCCCccccccc------ccCCCHHHHHHHHHHHHHHHH
Confidence 33455677764 799999999999999999999999999999999876321 356899999999999999985
|
The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. Some SNXs are localized in early endosome structures such as clathrin-coated pits, while others are located in late structures of the endocytic pathway. SNX30 harbors a Bin/Amphiphysin/Rvs (BAR) domain, which detects membrane curvature, C-terminal to the PX domain, similar to the sorting nexins SNX1-2, SNX4-8, and SNX32 |
| >cd07284 PX_SNX7 The phosphoinositide binding Phox Homology domain of Sorting Nexin 7 | Back alignment and domain information |
|---|
| >cd07282 PX_SNX2 The phosphoinositide binding Phox Homology domain of Sorting Nexin 2 | Back alignment and domain information |
|---|
| >cd07286 PX_SNX18 The phosphoinositide binding Phox Homology domain of Sorting Nexin 18 | Back alignment and domain information |
|---|
| >cd06864 PX_SNX4 The phosphoinositide binding Phox Homology domain of Sorting Nexin 4 | Back alignment and domain information |
|---|
| >cd07293 PX_SNX3 The phosphoinositide binding Phox Homology domain of Sorting Nexin 3 | Back alignment and domain information |
|---|
| >cd06860 PX_SNX7_30_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 7 and 30 | Back alignment and domain information |
|---|
| >cd06863 PX_Atg24p The phosphoinositide binding Phox Homology domain of yeast Atg24p, an autophagic degradation protein | Back alignment and domain information |
|---|
| >cd06894 PX_SNX3_like The phosphoinositide binding Phox Homology domain of Sorting Nexin 3 and related proteins | Back alignment and domain information |
|---|
| >cd06861 PX_Vps5p The phosphoinositide binding Phox Homology domain of yeast sorting nexin Vps5p | Back alignment and domain information |
|---|
| >cd07285 PX_SNX9 The phosphoinositide binding Phox Homology domain of Sorting Nexin 9 | Back alignment and domain information |
|---|
| >cd07295 PX_Grd19 The phosphoinositide binding Phox Homology domain of fungal Grd19 | Back alignment and domain information |
|---|
| >cd06865 PX_SNX_like The phosphoinositide binding Phox Homology domain of SNX-like proteins | Back alignment and domain information |
|---|
| >cd07294 PX_SNX12 The phosphoinositide binding Phox Homology domain of Sorting Nexin 12 | Back alignment and domain information |
|---|
| >cd07281 PX_SNX1 The phosphoinositide binding Phox Homology domain of Sorting Nexin 1 | Back alignment and domain information |
|---|
| >cd06867 PX_SNX41_42 The phosphoinositide binding Phox Homology domain of fungal Sorting Nexins 41 and 42 | Back alignment and domain information |
|---|
| >cd06891 PX_Vps17p The phosphoinositide binding Phox Homology domain of yeast sorting nexin Vps17p | Back alignment and domain information |
|---|
| >KOG2527|consensus | Back alignment and domain information |
|---|
| >cd06868 PX_HS1BP3 The phosphoinositide binding Phox Homology domain of HS1BP3 | Back alignment and domain information |
|---|
| >cd06866 PX_SNX8_Mvp1p_like The phosphoinositide binding Phox Homology domain of Sorting Nexin 8 and yeast Mvp1p | Back alignment and domain information |
|---|
| >cd06898 PX_SNX10 The phosphoinositide binding Phox Homology domain of Sorting Nexin 10 | Back alignment and domain information |
|---|
| >cd07288 PX_SNX15 The phosphoinositide binding Phox Homology domain of Sorting Nexin 15 | Back alignment and domain information |
|---|
| >cd06892 PX_SNX5_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 5 and 6 | Back alignment and domain information |
|---|
| >cd06862 PX_SNX9_18_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 9 and 18 | Back alignment and domain information |
|---|
| >cd07287 PX_RPK118_like The phosphoinositide binding Phox Homology domain of RPK118-like proteins | Back alignment and domain information |
|---|
| >cd06881 PX_SNX15_like The phosphoinositide binding Phox Homology domain of Sorting Nexin 15-like proteins | Back alignment and domain information |
|---|
| >cd06877 PX_SNX14 The phosphoinositide binding Phox Homology domain of Sorting Nexin 14 | Back alignment and domain information |
|---|
| >cd06859 PX_SNX1_2_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 1 and 2 | Back alignment and domain information |
|---|
| >cd07280 PX_YPT35 The phosphoinositide binding Phox Homology domain of the fungal protein YPT35 | Back alignment and domain information |
|---|
| >cd07292 PX_SNX6 The phosphoinositide binding Phox Homology domain of Sorting Nexin 6 | Back alignment and domain information |
|---|
| >cd06879 PX_UP1_plant The phosphoinositide binding Phox Homology domain of uncharacterized plant proteins | Back alignment and domain information |
|---|
| >cd07301 PX_SNX21 The phosphoinositide binding Phox Homology domain of Sorting Nexin 21 | Back alignment and domain information |
|---|
| >cd07276 PX_SNX16 The phosphoinositide binding Phox Homology domain of Sorting Nexin 16 | Back alignment and domain information |
|---|
| >cd06897 PX_SNARE The phosphoinositide binding Phox Homology domain of SNARE proteins from fungi | Back alignment and domain information |
|---|
| >cd07279 PX_SNX20_21_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 20 and 21 | Back alignment and domain information |
|---|
| >cd07300 PX_SNX20 The phosphoinositide binding Phox Homology domain of Sorting Nexin 20 | Back alignment and domain information |
|---|
| >cd07291 PX_SNX5 The phosphoinositide binding Phox Homology domain of Sorting Nexin 5 | Back alignment and domain information |
|---|
| >cd07277 PX_RUN The phosphoinositide binding Phox Homology domain of uncharacterized proteins containing PX and RUN domains | Back alignment and domain information |
|---|
| >cd06872 PX_SNX19_like_plant The phosphoinositide binding Phox Homology domain of uncharacterized SNX19-like plant proteins | Back alignment and domain information |
|---|
| >cd06873 PX_SNX13 The phosphoinositide binding Phox Homology domain of Sorting Nexin 13 | Back alignment and domain information |
|---|
| >cd06870 PX_CISK The phosphoinositide binding Phox Homology Domain of Cytokine-Independent Survival Kinase | Back alignment and domain information |
|---|
| >cd06886 PX_SNX27 The phosphoinositide binding Phox Homology domain of Sorting Nexin 27 | Back alignment and domain information |
|---|
| >cd06875 PX_IRAS The phosphoinositide binding Phox Homology domain of the Imidazoline Receptor Antisera-Selected | Back alignment and domain information |
|---|
| >cd06893 PX_SNX19 The phosphoinositide binding Phox Homology domain of Sorting Nexin 19 | Back alignment and domain information |
|---|
| >cd06874 PX_KIF16B_SNX23 The phosphoinositide binding Phox Homology domain of KIF16B kinesin or Sorting Nexin 23 | Back alignment and domain information |
|---|
| >cd06876 PX_MDM1p The phosphoinositide binding Phox Homology domain of yeast MDM1p | Back alignment and domain information |
|---|
| >smart00312 PX PhoX homologous domain, present in p47phox and p40phox | Back alignment and domain information |
|---|
| >cd06878 PX_SNX25 The phosphoinositide binding Phox Homology domain of Sorting Nexin 25 | Back alignment and domain information |
|---|
| >cd06885 PX_SNX17_31 The phosphoinositide binding Phox Homology domain of Sorting Nexins 17 and 31 | Back alignment and domain information |
|---|
| >cd06880 PX_SNX22 The phosphoinositide binding Phox Homology domain of Sorting Nexin 22 | Back alignment and domain information |
|---|
| >cd06883 PX_PI3K_C2 The phosphoinositide binding Phox Homology Domain of Class II Phosphoinositide 3-Kinases | Back alignment and domain information |
|---|
| >cd06882 PX_p40phox The phosphoinositide binding Phox Homology domain of the p40phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >cd06871 PX_MONaKA The phosphoinositide binding Phox Homology domain of Modulator of Na,K-ATPase | Back alignment and domain information |
|---|
| >cd06869 PX_UP2_fungi The phosphoinositide binding Phox Homology domain of uncharacterized fungal proteins | Back alignment and domain information |
|---|
| >cd06884 PX_PI3K_C2_68D The phosphoinositide binding Phox Homology Domain of Class II Phosphoinositide 3-Kinases similar to the Drosophila PI3K_68D protein | Back alignment and domain information |
|---|
| >cd06093 PX_domain The Phox Homology domain, a phosphoinositide binding module | Back alignment and domain information |
|---|
| >KOG2273|consensus | Back alignment and domain information |
|---|
| >PF00787 PX: PX domain; InterPro: IPR001683 The PX (phox) domain [] occurs in a variety of eukaryotic proteins and have been implicated in highly diverse functions such as cell signalling, vesicular trafficking, protein sorting and lipid modification [, , ] | Back alignment and domain information |
|---|
| >KOG2528|consensus | Back alignment and domain information |
|---|
| >cd06887 PX_p47phox The phosphoinositide binding Phox Homology domain of the p47phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >COG5391 Phox homology (PX) domain protein [Intracellular trafficking and secretion / General function prediction only] | Back alignment and domain information |
|---|
| >cd06888 PX_FISH The phosphoinositide binding Phox Homology domain of Five SH protein | Back alignment and domain information |
|---|
| >cd07290 PX_PI3K_C2_beta The phosphoinositide binding Phox Homology Domain of the Beta Isoform of Class II Phosphoinositide 3-Kinases | Back alignment and domain information |
|---|
| >cd07289 PX_PI3K_C2_alpha The phosphoinositide binding Phox Homology Domain of the Alpha Isoform of Class II Phosphoinositide 3-Kinases | Back alignment and domain information |
|---|
| >cd06890 PX_Bem1p The phosphoinositide binding Phox Homology domain of Bem1p | Back alignment and domain information |
|---|
| >cd06895 PX_PLD The phosphoinositide binding Phox Homology domain of Phospholipase D | Back alignment and domain information |
|---|
| >cd07296 PX_PLD1 The phosphoinositide binding Phox Homology domain of Phospholipase D1 | Back alignment and domain information |
|---|
| >KOG1259|consensus | Back alignment and domain information |
|---|
| >cd06889 PX_NoxO1 The phosphoinositide binding Phox Homology domain of Nox Organizing protein 1 | Back alignment and domain information |
|---|
| >cd06896 PX_PI3K_C2_gamma The phosphoinositide binding Phox Homology Domain of the Gamma Isoform of Class II Phosphoinositide 3-Kinases | Back alignment and domain information |
|---|
| >KOG2101|consensus | Back alignment and domain information |
|---|
| >cd07297 PX_PLD2 The phosphoinositide binding Phox Homology domain of Phospholipase D2 | Back alignment and domain information |
|---|
| >KOG3784|consensus | Back alignment and domain information |
|---|
| >KOG0905|consensus | Back alignment and domain information |
|---|
| >KOG1660|consensus | Back alignment and domain information |
|---|
| >KOG4773|consensus | Back alignment and domain information |
|---|
| >cd07298 PX_RICS The phosphoinositide binding Phox Homology domain of PX-RICS | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 83 | ||||
| 3iq2_A | 138 | Human Sorting Nexin 7, Phox Homology (Px) Domain Le | 8e-04 |
| >pdb|3IQ2|A Chain A, Human Sorting Nexin 7, Phox Homology (Px) Domain Length = 138 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 83 | |||
| 2i4k_A | 128 | Sorting nexin-1, SNX1; 3-stranded beta sheet, 3 al | 2e-16 | |
| 3iq2_A | 138 | Sorting nexin-7; SNX7, PHOX, protein signalling, S | 6e-16 | |
| 2csk_A | 146 | Sorting nexin 12; SNX12, PX domain, structural gen | 6e-16 | |
| 1kmd_A | 117 | VAM7P, vacuolar morphogenesis protein VAM7; PX dom | 9e-15 | |
| 3lui_A | 115 | Sorting nexin-17, SNX17; PX domain, endosome, phos | 2e-14 | |
| 4akv_A | 386 | Sorting nexin-33; transport protein, organelle bio | 6e-14 | |
| 3dyt_A | 366 | Sorting nexin-9; 3-helix bundle, BAR domain, PX do | 3e-12 | |
| 1ocs_A | 162 | Sorting nexin GRD19; sorting protein, PX-domain, y | 4e-12 | |
| 1xte_A | 154 | Serine/threonine-protein kinase SGK3; CISK, PX dom | 5e-12 | |
| 2v14_A | 134 | Kinesin-like motor protein C20ORF23; plus-END kine | 7e-11 | |
| 3p0c_A | 130 | Nischarin; structural genomics, structural genomic | 3e-10 | |
| 2ett_A | 128 | Sorting nexin-22; PX domain, BC019655, SNX22_human | 6e-08 | |
| 3hpc_X | 161 | SNX5 protein; sprting nexin, PHOX, SNX5-PX, phosph | 2e-07 | |
| 2ar5_A | 121 | Phosphoinositide 3-kinase; PX domain, transferase; | 2e-07 | |
| 2iwl_X | 140 | Phosphatidylinositol-4-phosphate 3-kinase C2 domai | 8e-07 | |
| 2wwe_A | 127 | Phosphoinositide-3-kinase, class 2, gamma polypept | 3e-06 | |
| 1kq6_A | 141 | NCF-1, P47PHOX, neutrophil cytosol factor 1; alpha | 1e-05 | |
| 2l73_A | 149 | NADPH oxidase organizer 1; cell membrane, PX domai | 3e-04 | |
| 1h6h_A | 143 | Neutrophil cytosol factor 4; PX domain; HET: PIB; | 6e-04 |
| >2i4k_A Sorting nexin-1, SNX1; 3-stranded beta sheet, 3 alpha helices, proline rich loop, protein transport; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
Score = 67.6 bits (165), Expect = 2e-16
Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 2/68 (2%)
Query: 15 QNKLSIVWRRYSEFEQMKNYLQATYPY--VILPPLPEKKPTFVWKHDAASTDITDPDFVD 72
++K V RR+S+F + L + I+PP PEK + K D + +F++
Sbjct: 36 RSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLE 95
Query: 73 RRRASLEV 80
+RRA+LE
Sbjct: 96 KRRAALER 103
|
| >3iq2_A Sorting nexin-7; SNX7, PHOX, protein signalling, SGC, structur genomics consortium, protein transport, transport; 1.70A {Homo sapiens} Length = 138 | Back alignment and structure |
|---|
| >2csk_A Sorting nexin 12; SNX12, PX domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 146 | Back alignment and structure |
|---|
| >1kmd_A VAM7P, vacuolar morphogenesis protein VAM7; PX domain, phosphoinositide binding, endocytosis/exocytosis complex; NMR {Saccharomyces cerevisiae} SCOP: d.189.1.1 Length = 117 | Back alignment and structure |
|---|
| >3lui_A Sorting nexin-17, SNX17; PX domain, endosome, phosphoprotein, P transport, transport; 1.80A {Homo sapiens} PDB: 3fog_A Length = 115 | Back alignment and structure |
|---|
| >4akv_A Sorting nexin-33; transport protein, organelle biogenesis; 2.65A {Homo sapiens} Length = 386 | Back alignment and structure |
|---|
| >3dyt_A Sorting nexin-9; 3-helix bundle, BAR domain, PX domain, phosphoprotein, protein transport, SH3 domain, transport, transport protein; 2.08A {Homo sapiens} PDB: 3dyu_A 2raj_A 2rai_A 2rak_A* Length = 366 | Back alignment and structure |
|---|
| >1ocs_A Sorting nexin GRD19; sorting protein, PX-domain, yeast protein; HET: CME; 2.03A {Saccharomyces cerevisiae} SCOP: d.189.1.1 PDB: 1ocu_A* Length = 162 | Back alignment and structure |
|---|
| >1xte_A Serine/threonine-protein kinase SGK3; CISK, PX domain, transferase; 1.60A {Mus musculus} SCOP: d.189.1.1 PDB: 1xtn_A Length = 154 | Back alignment and structure |
|---|
| >2v14_A Kinesin-like motor protein C20ORF23; plus-END kinesin complex, transport protein, phosphatidylinositol 3-phosphate binding, nucleotide-binding; 2.20A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >3p0c_A Nischarin; structural genomics, structural genomics consortium, SGC, PX signaling protein; 2.27A {Homo sapiens} Length = 130 | Back alignment and structure |
|---|
| >2ett_A Sorting nexin-22; PX domain, BC019655, SNX22_human, HS.157607, structural genomics,protein structure initiative PSI; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >3hpc_X SNX5 protein; sprting nexin, PHOX, SNX5-PX, phosphatidylinositol, PI(4,5)P2, cell adhesion, protein transport; 1.47A {Rattus norvegicus} PDB: 3hpb_A Length = 161 | Back alignment and structure |
|---|
| >2ar5_A Phosphoinositide 3-kinase; PX domain, transferase; 1.80A {Homo sapiens} PDB: 2rea_A 2red_A Length = 121 | Back alignment and structure |
|---|
| >2iwl_X Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing alpha polypeptide; PI3K, PX domain, transferase; 2.6A {Homo sapiens} Length = 140 | Back alignment and structure |
|---|
| >2wwe_A Phosphoinositide-3-kinase, class 2, gamma polypeptide; phosphoprotein, nucleotide-binding, PIK3C2G, membrane, PX-domain, transferase, ATP-binding; 1.25A {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >1kq6_A NCF-1, P47PHOX, neutrophil cytosol factor 1; alpha beta, PX domain, NADPH oxidase, protein binding; HET: MSE; 1.18A {Homo sapiens} SCOP: d.189.1.1 PDB: 1gd5_A 1o7k_A Length = 141 | Back alignment and structure |
|---|
| >2l73_A NADPH oxidase organizer 1; cell membrane, PX domain, oxidoreductase regulator; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >1h6h_A Neutrophil cytosol factor 4; PX domain; HET: PIB; 1.7A {Homo sapiens} SCOP: d.189.1.1 Length = 143 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 83 | |||
| 3iq2_A | 138 | Sorting nexin-7; SNX7, PHOX, protein signalling, S | 99.86 | |
| 1ocs_A | 162 | Sorting nexin GRD19; sorting protein, PX-domain, y | 99.84 | |
| 2i4k_A | 128 | Sorting nexin-1, SNX1; 3-stranded beta sheet, 3 al | 99.83 | |
| 2csk_A | 146 | Sorting nexin 12; SNX12, PX domain, structural gen | 99.82 | |
| 2v14_A | 134 | Kinesin-like motor protein C20ORF23; plus-END kine | 99.8 | |
| 3lui_A | 115 | Sorting nexin-17, SNX17; PX domain, endosome, phos | 99.8 | |
| 1kmd_A | 117 | VAM7P, vacuolar morphogenesis protein VAM7; PX dom | 99.79 | |
| 3hpc_X | 161 | SNX5 protein; sprting nexin, PHOX, SNX5-PX, phosph | 99.79 | |
| 2ar5_A | 121 | Phosphoinositide 3-kinase; PX domain, transferase; | 99.76 | |
| 3dyt_A | 366 | Sorting nexin-9; 3-helix bundle, BAR domain, PX do | 99.74 | |
| 4akv_A | 386 | Sorting nexin-33; transport protein, organelle bio | 99.74 | |
| 3p0c_A | 130 | Nischarin; structural genomics, structural genomic | 99.74 | |
| 1xte_A | 154 | Serine/threonine-protein kinase SGK3; CISK, PX dom | 99.74 | |
| 1h6h_A | 143 | Neutrophil cytosol factor 4; PX domain; HET: PIB; | 99.73 | |
| 2ett_A | 128 | Sorting nexin-22; PX domain, BC019655, SNX22_human | 99.72 | |
| 4az9_A | 129 | Sorting nexin-24; protein transport; 1.75A {Homo s | 99.7 | |
| 1kq6_A | 141 | NCF-1, P47PHOX, neutrophil cytosol factor 1; alpha | 99.69 | |
| 2iwl_X | 140 | Phosphatidylinositol-4-phosphate 3-kinase C2 domai | 99.68 | |
| 2v6v_A | 156 | BUD emergence protein 1; homotypic fusion, regulat | 99.6 | |
| 2l73_A | 149 | NADPH oxidase organizer 1; cell membrane, PX domai | 99.54 | |
| 2wwe_A | 127 | Phosphoinositide-3-kinase, class 2, gamma polypept | 99.35 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 99.25 |
| >3iq2_A Sorting nexin-7; SNX7, PHOX, protein signalling, SGC, structur genomics consortium, protein transport, transport; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.86 E-value=2.7e-22 Score=129.24 Aligned_cols=69 Identities=29% Similarity=0.368 Sum_probs=56.9
Q ss_pred ccccCCCC-CceeeecccchHHHHHHHHHHHCCCCCCCCCCCCCccccccccCCCCCCCCHHHHHHHHHHHHHhhC
Q psy12925 9 WSLIPKQN-KLSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLEVIDY 83 (83)
Q Consensus 9 ~~~~p~~~-k~~~V~RRYSdF~~L~~~L~~~~p~~~iPplP~K~~~~~~~~~~~~~~~~~~~fie~Rr~~Le~fL~ 83 (83)
-++.|.+. ++|.|+||||||.||++.|.+.||++.+||||+|..++.+ .++++++|||+||++||.||+
T Consensus 34 ~t~~~~f~~~~~~V~RRYsdF~~L~~~L~~~~p~~~iP~lP~K~~~~~~------~~~~~~~fie~Rr~~Le~fL~ 103 (138)
T 3iq2_A 34 KTSRGEFDSSEFEVRRRYQDFLWLKGKLEEAHPTLIIPPLPEKFIVKGM------VERFNDDFIETRRKALHKFLN 103 (138)
T ss_dssp ESCSSSSSCCEEEEEEEHHHHHHHHHHHHHHCTTSCCCCCCCCC----C------CGGGCHHHHHHHHHHHHHHHH
T ss_pred EECCCCcCCCeEEEEcChHHHHHHHHHHHHHCcCcccCCCCcchhhccc------cccCCHHHHHHHHHHHHHHHH
Confidence 34556665 4799999999999999999999999999999999987421 246799999999999999985
|
| >1ocs_A Sorting nexin GRD19; sorting protein, PX-domain, yeast protein; HET: CME; 2.03A {Saccharomyces cerevisiae} SCOP: d.189.1.1 PDB: 1ocu_A* | Back alignment and structure |
|---|
| >2i4k_A Sorting nexin-1, SNX1; 3-stranded beta sheet, 3 alpha helices, proline rich loop, protein transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csk_A Sorting nexin 12; SNX12, PX domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v14_A Kinesin-like motor protein C20ORF23; plus-END kinesin complex, transport protein, phosphatidylinositol 3-phosphate binding, nucleotide-binding; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3lui_A Sorting nexin-17, SNX17; PX domain, endosome, phosphoprotein, P transport, transport; 1.80A {Homo sapiens} PDB: 3fog_A | Back alignment and structure |
|---|
| >1kmd_A VAM7P, vacuolar morphogenesis protein VAM7; PX domain, phosphoinositide binding, endocytosis/exocytosis complex; NMR {Saccharomyces cerevisiae} SCOP: d.189.1.1 | Back alignment and structure |
|---|
| >3hpc_X SNX5 protein; sprting nexin, PHOX, SNX5-PX, phosphatidylinositol, PI(4,5)P2, cell adhesion, protein transport; 1.47A {Rattus norvegicus} PDB: 3hpb_A | Back alignment and structure |
|---|
| >2ar5_A Phosphoinositide 3-kinase; PX domain, transferase; 1.80A {Homo sapiens} PDB: 2rea_A 2red_A | Back alignment and structure |
|---|
| >3dyt_A Sorting nexin-9; 3-helix bundle, BAR domain, PX domain, phosphoprotein, protein transport, SH3 domain, transport, transport protein; 2.08A {Homo sapiens} PDB: 3dyu_A 2raj_A 2rai_A 2rak_A* | Back alignment and structure |
|---|
| >4akv_A Sorting nexin-33; transport protein, organelle biogenesis; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3p0c_A Nischarin; structural genomics, structural genomics consortium, SGC, PX signaling protein; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >1xte_A Serine/threonine-protein kinase SGK3; CISK, PX domain, transferase; 1.60A {Mus musculus} SCOP: d.189.1.1 PDB: 1xtn_A | Back alignment and structure |
|---|
| >1h6h_A Neutrophil cytosol factor 4; PX domain; HET: PIB; 1.7A {Homo sapiens} SCOP: d.189.1.1 | Back alignment and structure |
|---|
| >2ett_A Sorting nexin-22; PX domain, BC019655, SNX22_human, HS.157607, structural genomics,protein structure initiative PSI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4az9_A Sorting nexin-24; protein transport; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1kq6_A NCF-1, P47PHOX, neutrophil cytosol factor 1; alpha beta, PX domain, NADPH oxidase, protein binding; HET: MSE; 1.18A {Homo sapiens} SCOP: d.189.1.1 PDB: 1gd5_A 1o7k_A | Back alignment and structure |
|---|
| >2iwl_X Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing alpha polypeptide; PI3K, PX domain, transferase; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >2v6v_A BUD emergence protein 1; homotypic fusion, regulator, PI3P, 3-kinase, PX domain, SH3 domain, cytoskeleton, cell polarity; 1.5A {Saccharomyces cerevisiae} PDB: 2czo_A | Back alignment and structure |
|---|
| >2l73_A NADPH oxidase organizer 1; cell membrane, PX domain, oxidoreductase regulator; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wwe_A Phosphoinositide-3-kinase, class 2, gamma polypeptide; phosphoprotein, nucleotide-binding, PIK3C2G, membrane, PX-domain, transferase, ATP-binding; 1.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 83 | ||||
| d1kmda_ | 117 | d.189.1.1 (A:) Vam7p {Baker's yeast (Saccharomyces | 3e-11 | |
| d1kq6a_ | 140 | d.189.1.1 (A:) p47phox NADPH oxidase {Human (Homo | 4e-08 | |
| d1xtea_ | 116 | d.189.1.1 (A:) Serine/threonine-protein kinase Sgk | 7e-07 | |
| d1ocsa_ | 132 | d.189.1.1 (A:) Sorting nexin grd19 {Baker's yeast | 8e-07 | |
| d1h6ha_ | 143 | d.189.1.1 (A:) p40phox NADPH oxidase {Human (Homo | 5e-04 |
| >d1kmda_ d.189.1.1 (A:) Vam7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 117 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: PX domain superfamily: PX domain family: PX domain domain: Vam7p species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 52.7 bits (126), Expect = 3e-11
Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 3/59 (5%)
Query: 21 VWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLE 79
+++RYSEF ++K L+ I PEK + DP+ +D RR LE
Sbjct: 31 LYKRYSEFWKLKTRLERDVGSTIPYDFPEKPGVLDRRW---QRRYDDPEMIDERRIGLE 86
|
| >d1kq6a_ d.189.1.1 (A:) p47phox NADPH oxidase {Human (Homo sapiens) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d1xtea_ d.189.1.1 (A:) Serine/threonine-protein kinase Sgk3, Cisk {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 | Back information, alignment and structure |
|---|
| >d1ocsa_ d.189.1.1 (A:) Sorting nexin grd19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 132 | Back information, alignment and structure |
|---|
| >d1h6ha_ d.189.1.1 (A:) p40phox NADPH oxidase {Human (Homo sapiens) [TaxId: 9606]} Length = 143 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 83 | |||
| d1kmda_ | 117 | Vam7p {Baker's yeast (Saccharomyces cerevisiae) [T | 99.77 | |
| d1ocsa_ | 132 | Sorting nexin grd19 {Baker's yeast (Saccharomyces | 99.76 | |
| d1xtea_ | 116 | Serine/threonine-protein kinase Sgk3, Cisk {Mouse | 99.66 | |
| d1kq6a_ | 140 | p47phox NADPH oxidase {Human (Homo sapiens) [TaxId | 99.63 | |
| d1h6ha_ | 143 | p40phox NADPH oxidase {Human (Homo sapiens) [TaxId | 99.61 |
| >d1kmda_ d.189.1.1 (A:) Vam7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: PX domain superfamily: PX domain family: PX domain domain: Vam7p species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.77 E-value=1.9e-19 Score=111.55 Aligned_cols=64 Identities=28% Similarity=0.382 Sum_probs=56.3
Q ss_pred CceeeecccchHHHHHHHHHHHCCCCCCCCCCCCCccccccccCCCCCCCCHHHHHHHHHHHHHhhC
Q psy12925 17 KLSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLEVIDY 83 (83)
Q Consensus 17 k~~~V~RRYSdF~~L~~~L~~~~p~~~iPplP~K~~~~~~~~~~~~~~~~~~~fie~Rr~~Le~fL~ 83 (83)
+.+.|+||||||.+||+.|...||+..+||+|+|..++.+. ...+++++++||+|+++||.||+
T Consensus 27 ~~~~V~RRYsdF~~L~~~L~~~~~~~~~p~lP~K~~~~~~~---~~~~~~~~~~ie~R~~~Le~yL~ 90 (117)
T d1kmda_ 27 PNKRLYKRYSEFWKLKTRLERDVGSTIPYDFPEKPGVLDRR---WQRRYDDPEMIDERRIGLERFLN 90 (117)
T ss_dssp SSCCEEECHHHHHHHHHHHHHHHCSCCCCCCCCCCCSSCST---TCCCTTCHHHHHHHHTTHHHHHH
T ss_pred CCEEEEehHHHHHHHHHHHHHHCCCCcCCCCCccccccccc---cccCCCCHHHHHHHHHHHHHHHH
Confidence 47899999999999999999999999999999999875332 22577899999999999999984
|
| >d1ocsa_ d.189.1.1 (A:) Sorting nexin grd19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xtea_ d.189.1.1 (A:) Serine/threonine-protein kinase Sgk3, Cisk {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kq6a_ d.189.1.1 (A:) p47phox NADPH oxidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ha_ d.189.1.1 (A:) p40phox NADPH oxidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|