Psyllid ID: psy12925


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80---
MCLVTDEDWSLIPKQNKLSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLEVIDY
ccEEccccccccccccccEEEEEEccHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHcccccc
ccccccccccccccccccEEEEHHHHHHHHHHHHHHHHccEEEEcccccccEEEEEEccccccccccHHHHHHHHHHHHHHcc
mclvtdedwslipkqnklSIVWRRYSEFEQMKNYLQatypyvilpplpekkptfvwkhdaastditdpdfvdrrraslevidy
mclvtdedwslipkqnklsiVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHdaastditdpdfvDRRRASLEVIDY
MCLVTDEDWSLIPKQNKLSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLEVIDY
**LVTDEDWSLIPKQNKLSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDI******************
*CLVTDE************IVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLEVIDY
MCLVTDEDWSLIPKQNKLSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLEVIDY
*CLVTDEDWSLIPKQNKLSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLEVIDY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCLVTDEDWSLIPKQNKLSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLEVIDY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query83 2.2.26 [Sep-21-2011]
Q91YJ2 450 Sorting nexin-4 OS=Mus mu yes N/A 0.686 0.126 0.593 5e-15
A1A4L0 450 Sorting nexin-4 OS=Bos ta yes N/A 0.686 0.126 0.576 3e-14
O95219 450 Sorting nexin-4 OS=Homo s yes N/A 0.686 0.126 0.559 1e-13
Q5R4C2 450 Sorting nexin-4 OS=Pongo yes N/A 0.686 0.126 0.559 1e-13
Q6BZE1 625 Autophagy-related protein yes N/A 0.445 0.059 0.459 0.0002
Q6C9X0 570 Sorting nexin-41 OS=Yarro yes N/A 0.698 0.101 0.377 0.0003
Q9CWK8 519 Sorting nexin-2 OS=Mus mu no N/A 0.710 0.113 0.377 0.0004
Q5R9A9 523 Sorting nexin-2 OS=Pongo no N/A 0.710 0.112 0.377 0.0004
P0C220 523 Sorting nexin-2 OS=Macaca N/A N/A 0.710 0.112 0.377 0.0004
Q2TBW7 519 Sorting nexin-2 OS=Bos ta no N/A 0.710 0.113 0.377 0.0004
>sp|Q91YJ2|SNX4_MOUSE Sorting nexin-4 OS=Mus musculus GN=Snx4 PE=2 SV=1 Back     alignment and function desciption
 Score = 79.7 bits (195), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 43/59 (72%), Gaps = 2/59 (3%)

Query: 21  VWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLE 79
           +WRRYSEFE ++NYL   YP+V++PPLPEK+  FVW     S D  DPDFV+RRR  LE
Sbjct: 103 LWRRYSEFELLRNYLLVYYPHVVVPPLPEKRAEFVWHK--LSADNMDPDFVERRRVGLE 159




May be involved in several stages of intracellular trafficking. Plays a role in recycling endocytosed transferrin receptor and prevent its degradation.
Mus musculus (taxid: 10090)
>sp|A1A4L0|SNX4_BOVIN Sorting nexin-4 OS=Bos taurus GN=SNX4 PE=2 SV=1 Back     alignment and function description
>sp|O95219|SNX4_HUMAN Sorting nexin-4 OS=Homo sapiens GN=SNX4 PE=1 SV=1 Back     alignment and function description
>sp|Q5R4C2|SNX4_PONAB Sorting nexin-4 OS=Pongo abelii GN=SNX4 PE=2 SV=1 Back     alignment and function description
>sp|Q6BZE1|ATG20_DEBHA Autophagy-related protein 20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG20 PE=3 SV=2 Back     alignment and function description
>sp|Q6C9X0|SNX41_YARLI Sorting nexin-41 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SNX41 PE=3 SV=1 Back     alignment and function description
>sp|Q9CWK8|SNX2_MOUSE Sorting nexin-2 OS=Mus musculus GN=Snx2 PE=1 SV=2 Back     alignment and function description
>sp|Q5R9A9|SNX2_PONAB Sorting nexin-2 OS=Pongo abelii GN=SNX2 PE=2 SV=1 Back     alignment and function description
>sp|P0C220|SNX2_MACFA Sorting nexin-2 OS=Macaca fascicularis GN=SNX2 PE=2 SV=1 Back     alignment and function description
>sp|Q2TBW7|SNX2_BOVIN Sorting nexin-2 OS=Bos taurus GN=SNX2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query83
357611857 419 putative Sorting nexin 4 [Danaus plexipp 0.843 0.167 0.526 3e-17
189234487 417 PREDICTED: similar to sorting nexin 4 [T 0.734 0.146 0.634 7e-17
270001727 415 hypothetical protein TcasGA2_TC000603 [T 0.734 0.146 0.634 7e-17
242015880 421 Sorting nexin-4, putative [Pediculus hum 0.734 0.144 0.650 2e-16
383856120 416 PREDICTED: sorting nexin-4-like [Megachi 0.734 0.146 0.571 1e-15
307180190 422 Sorting nexin-4 [Camponotus floridanus] 0.867 0.170 0.526 4e-15
332016453 416 Sorting nexin-4 [Acromyrmex echinatior] 0.867 0.173 0.526 6e-15
307209903 421 Sorting nexin-4 [Harpegnathos saltator] 0.843 0.166 0.538 6e-15
322793257 380 hypothetical protein SINV_14846 [Solenop 0.746 0.163 0.562 8e-15
348524588 476 PREDICTED: sorting nexin-4-like [Oreochr 0.686 0.119 0.610 8e-15
>gi|357611857|gb|EHJ67683.1| putative Sorting nexin 4 [Danaus plexippus] Back     alignment and taxonomy information
 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/76 (52%), Positives = 61/76 (80%), Gaps = 6/76 (7%)

Query: 4   VTDEDWSLIPKQNKLSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAAST 63
           VTD +++++  Q+K+S +WRRY+EFEQ+ +YLQ TYP+V++PPLPEK+  + W+     +
Sbjct: 63  VTDPEYNIV--QSKISTIWRRYTEFEQIHDYLQVTYPHVVIPPLPEKRVLYAWR----KS 116

Query: 64  DITDPDFVDRRRASLE 79
           D TDP+FV+RRRA+LE
Sbjct: 117 DTTDPEFVERRRAALE 132




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189234487|ref|XP_970429.2| PREDICTED: similar to sorting nexin 4 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270001727|gb|EEZ98174.1| hypothetical protein TcasGA2_TC000603 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242015880|ref|XP_002428575.1| Sorting nexin-4, putative [Pediculus humanus corporis] gi|212513209|gb|EEB15837.1| Sorting nexin-4, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|383856120|ref|XP_003703558.1| PREDICTED: sorting nexin-4-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307180190|gb|EFN68223.1| Sorting nexin-4 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332016453|gb|EGI57366.1| Sorting nexin-4 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307209903|gb|EFN86682.1| Sorting nexin-4 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322793257|gb|EFZ16914.1| hypothetical protein SINV_14846 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|348524588|ref|XP_003449805.1| PREDICTED: sorting nexin-4-like [Oreochromis niloticus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query83
ZFIN|ZDB-GENE-030131-1923 434 snx4 "sorting nexin 4" [Danio 0.686 0.131 0.627 1.8e-15
UNIPROTKB|E1BQF6 402 SNX4 "Uncharacterized protein" 0.686 0.141 0.610 3.1e-15
UNIPROTKB|F1PPA2 403 SNX4 "Uncharacterized protein" 0.686 0.141 0.610 1.4e-14
UNIPROTKB|F8W9T3155 SNX4 "Sorting nexin-4" [Homo s 0.686 0.367 0.576 1.4e-14
MGI|MGI:1916400 450 Snx4 "sorting nexin 4" [Mus mu 0.686 0.126 0.610 1.5e-14
RGD|1309763 450 Snx4 "sorting nexin 4" [Rattus 0.686 0.126 0.610 1.9e-14
UNIPROTKB|A1A4L0 450 SNX4 "Sorting nexin-4" [Bos ta 0.686 0.126 0.593 2.4e-14
UNIPROTKB|O95219 450 SNX4 "Sorting nexin-4" [Homo s 0.686 0.126 0.576 8.5e-14
UNIPROTKB|Q5R4C2 450 SNX4 "Sorting nexin-4" [Pongo 0.686 0.126 0.576 8.5e-14
POMBASE|SPCC16A11.08 534 atg20 "sorting nexin Atg20 (pr 0.903 0.140 0.325 1.9e-05
ZFIN|ZDB-GENE-030131-1923 snx4 "sorting nexin 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 201 (75.8 bits), Expect = 1.8e-15, P = 1.8e-15
 Identities = 37/59 (62%), Positives = 45/59 (76%)

Query:    21 VWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLE 79
             +WRRYSEFE ++NYL  TYP+V++PPLPEK+  FVW H   S D  DPDFV+RRR  LE
Sbjct:    87 LWRRYSEFELLRNYLLVTYPFVVVPPLPEKRAEFVW-HKL-SADNMDPDFVERRRVGLE 143




GO:0035091 "phosphatidylinositol binding" evidence=IEA
GO:0007154 "cell communication" evidence=IEA
UNIPROTKB|E1BQF6 SNX4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PPA2 SNX4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F8W9T3 SNX4 "Sorting nexin-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1916400 Snx4 "sorting nexin 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309763 Snx4 "sorting nexin 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A1A4L0 SNX4 "Sorting nexin-4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O95219 SNX4 "Sorting nexin-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R4C2 SNX4 "Sorting nexin-4" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
POMBASE|SPCC16A11.08 atg20 "sorting nexin Atg20 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O95219SNX4_HUMANNo assigned EC number0.55930.68670.1266yesN/A
Q5R4C2SNX4_PONABNo assigned EC number0.55930.68670.1266yesN/A
A1A4L0SNX4_BOVINNo assigned EC number0.57620.68670.1266yesN/A
Q91YJ2SNX4_MOUSENo assigned EC number0.59320.68670.1266yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query83
cd06864129 cd06864, PX_SNX4, The phosphoinositide binding Pho 1e-30
cd06093106 cd06093, PX_domain, The Phox Homology domain, a ph 1e-12
cd06859114 cd06859, PX_SNX1_2_like, The phosphoinositide bind 1e-11
smart00312105 smart00312, PX, PhoX homologous domain, present in 4e-11
pfam00787109 pfam00787, PX, PX domain 5e-11
cd06867112 cd06867, PX_SNX41_42, The phosphoinositide binding 3e-09
cd06866105 cd06866, PX_SNX8_Mvp1p_like, The phosphoinositide 4e-08
cd06898113 cd06898, PX_SNX10, The phosphoinositide binding Ph 1e-07
cd06861112 cd06861, PX_Vps5p, The phosphoinositide binding Ph 6e-07
cd06876133 cd06876, PX_MDM1p, The phosphoinositide binding Ph 2e-06
COG5391 524 COG5391, COG5391, Phox homology (PX) domain protei 3e-06
cd07282124 cd07282, PX_SNX2, The phosphoinositide binding Pho 3e-06
cd06865120 cd06865, PX_SNX_like, The phosphoinositide binding 5e-06
cd06860116 cd06860, PX_SNX7_30_like, The phosphoinositide bin 5e-06
cd06894123 cd06894, PX_SNX3_like, The phosphoinositide bindin 9e-06
cd07280120 cd07280, PX_YPT35, The phosphoinositide binding Ph 9e-06
cd06863118 cd06863, PX_Atg24p, The phosphoinositide binding P 2e-05
cd06868120 cd06868, PX_HS1BP3, The phosphoinositide binding P 3e-05
cd07294132 cd07294, PX_SNX12, The phosphoinositide binding Ph 3e-05
cd06897108 cd06897, PX_SNARE, The phosphoinositide binding Ph 7e-05
cd07284116 cd07284, PX_SNX7, The phosphoinositide binding Pho 9e-05
cd07283116 cd07283, PX_SNX30, The phosphoinositide binding Ph 3e-04
cd06883109 cd06883, PX_PI3K_C2, The phosphoinositide binding 4e-04
cd07295116 cd07295, PX_Grd19, The phosphoinositide binding Ph 4e-04
cd07281124 cd07281, PX_SNX1, The phosphoinositide binding Pho 7e-04
cd06862125 cd06862, PX_SNX9_18_like, The phosphoinositide bin 0.001
cd06874127 cd06874, PX_KIF16B_SNX23, The phosphoinositide bin 0.001
cd07293123 cd07293, PX_SNX3, The phosphoinositide binding Pho 0.002
>gnl|CDD|132774 cd06864, PX_SNX4, The phosphoinositide binding Phox Homology domain of Sorting Nexin 4 Back     alignment and domain information
 Score =  103 bits (260), Expect = 1e-30
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 2/63 (3%)

Query: 17  KLSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRA 76
           KLS +WRRYSEFE ++NYL  TYPYVI+PPLPEK+  F+W+    S+D  DPDFV+RRRA
Sbjct: 44  KLSSLWRRYSEFELLRNYLVVTYPYVIVPPLPEKRAMFMWQK--LSSDTFDPDFVERRRA 101

Query: 77  SLE 79
            LE
Sbjct: 102 GLE 104


The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. SNX4 is involved in recycling traffic from the sorting endosome (post-Golgi endosome) back to the late Golgi. It shows a similar domain architecture as SNX1-2, among others, containing a Bin/Amphiphysin/Rvs (BAR) domain, which detects membrane curvature, C-terminal to the PX domain. SNX4 is implicated in the regulation of plasma membrane receptor trafficking and interacts with receptors for EGF, insulin, platelet-derived growth factor and the long form of the leptin receptor. Length = 129

>gnl|CDD|132768 cd06093, PX_domain, The Phox Homology domain, a phosphoinositide binding module Back     alignment and domain information
>gnl|CDD|132769 cd06859, PX_SNX1_2_like, The phosphoinositide binding Phox Homology domain of Sorting Nexins 1 and 2 Back     alignment and domain information
>gnl|CDD|214610 smart00312, PX, PhoX homologous domain, present in p47phox and p40phox Back     alignment and domain information
>gnl|CDD|216119 pfam00787, PX, PX domain Back     alignment and domain information
>gnl|CDD|132777 cd06867, PX_SNX41_42, The phosphoinositide binding Phox Homology domain of fungal Sorting Nexins 41 and 42 Back     alignment and domain information
>gnl|CDD|132776 cd06866, PX_SNX8_Mvp1p_like, The phosphoinositide binding Phox Homology domain of Sorting Nexin 8 and yeast Mvp1p Back     alignment and domain information
>gnl|CDD|132808 cd06898, PX_SNX10, The phosphoinositide binding Phox Homology domain of Sorting Nexin 10 Back     alignment and domain information
>gnl|CDD|132771 cd06861, PX_Vps5p, The phosphoinositide binding Phox Homology domain of yeast sorting nexin Vps5p Back     alignment and domain information
>gnl|CDD|132786 cd06876, PX_MDM1p, The phosphoinositide binding Phox Homology domain of yeast MDM1p Back     alignment and domain information
>gnl|CDD|227680 COG5391, COG5391, Phox homology (PX) domain protein [Intracellular trafficking and secretion / General function prediction only] Back     alignment and domain information
>gnl|CDD|132815 cd07282, PX_SNX2, The phosphoinositide binding Phox Homology domain of Sorting Nexin 2 Back     alignment and domain information
>gnl|CDD|132775 cd06865, PX_SNX_like, The phosphoinositide binding Phox Homology domain of SNX-like proteins Back     alignment and domain information
>gnl|CDD|132770 cd06860, PX_SNX7_30_like, The phosphoinositide binding Phox Homology domain of Sorting Nexins 7 and 30 Back     alignment and domain information
>gnl|CDD|132804 cd06894, PX_SNX3_like, The phosphoinositide binding Phox Homology domain of Sorting Nexin 3 and related proteins Back     alignment and domain information
>gnl|CDD|132813 cd07280, PX_YPT35, The phosphoinositide binding Phox Homology domain of the fungal protein YPT35 Back     alignment and domain information
>gnl|CDD|132773 cd06863, PX_Atg24p, The phosphoinositide binding Phox Homology domain of yeast Atg24p, an autophagic degradation protein Back     alignment and domain information
>gnl|CDD|132778 cd06868, PX_HS1BP3, The phosphoinositide binding Phox Homology domain of HS1BP3 Back     alignment and domain information
>gnl|CDD|132827 cd07294, PX_SNX12, The phosphoinositide binding Phox Homology domain of Sorting Nexin 12 Back     alignment and domain information
>gnl|CDD|132807 cd06897, PX_SNARE, The phosphoinositide binding Phox Homology domain of SNARE proteins from fungi Back     alignment and domain information
>gnl|CDD|132817 cd07284, PX_SNX7, The phosphoinositide binding Phox Homology domain of Sorting Nexin 7 Back     alignment and domain information
>gnl|CDD|132816 cd07283, PX_SNX30, The phosphoinositide binding Phox Homology domain of Sorting Nexin 30 Back     alignment and domain information
>gnl|CDD|132793 cd06883, PX_PI3K_C2, The phosphoinositide binding Phox Homology Domain of Class II Phosphoinositide 3-Kinases Back     alignment and domain information
>gnl|CDD|132828 cd07295, PX_Grd19, The phosphoinositide binding Phox Homology domain of fungal Grd19 Back     alignment and domain information
>gnl|CDD|132814 cd07281, PX_SNX1, The phosphoinositide binding Phox Homology domain of Sorting Nexin 1 Back     alignment and domain information
>gnl|CDD|132772 cd06862, PX_SNX9_18_like, The phosphoinositide binding Phox Homology domain of Sorting Nexins 9 and 18 Back     alignment and domain information
>gnl|CDD|132784 cd06874, PX_KIF16B_SNX23, The phosphoinositide binding Phox Homology domain of KIF16B kinesin or Sorting Nexin 23 Back     alignment and domain information
>gnl|CDD|132826 cd07293, PX_SNX3, The phosphoinositide binding Phox Homology domain of Sorting Nexin 3 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 83
cd07283116 PX_SNX30 The phosphoinositide binding Phox Homolog 99.89
cd07284116 PX_SNX7 The phosphoinositide binding Phox Homology 99.89
cd07282124 PX_SNX2 The phosphoinositide binding Phox Homology 99.88
cd07286127 PX_SNX18 The phosphoinositide binding Phox Homolog 99.88
cd06864129 PX_SNX4 The phosphoinositide binding Phox Homology 99.87
cd07293123 PX_SNX3 The phosphoinositide binding Phox Homology 99.87
cd06860116 PX_SNX7_30_like The phosphoinositide binding Phox 99.86
cd06863118 PX_Atg24p The phosphoinositide binding Phox Homolo 99.86
cd06894123 PX_SNX3_like The phosphoinositide binding Phox Hom 99.86
cd06861112 PX_Vps5p The phosphoinositide binding Phox Homolog 99.85
cd07285126 PX_SNX9 The phosphoinositide binding Phox Homology 99.85
cd07295116 PX_Grd19 The phosphoinositide binding Phox Homolog 99.85
cd06865120 PX_SNX_like The phosphoinositide binding Phox Homo 99.85
cd07294132 PX_SNX12 The phosphoinositide binding Phox Homolog 99.85
cd07281124 PX_SNX1 The phosphoinositide binding Phox Homology 99.85
cd06867112 PX_SNX41_42 The phosphoinositide binding Phox Homo 99.84
cd06891140 PX_Vps17p The phosphoinositide binding Phox Homolo 99.84
KOG2527|consensus144 99.83
cd06868120 PX_HS1BP3 The phosphoinositide binding Phox Homolo 99.83
cd06866105 PX_SNX8_Mvp1p_like The phosphoinositide binding Ph 99.83
cd06898113 PX_SNX10 The phosphoinositide binding Phox Homolog 99.83
cd07288118 PX_SNX15 The phosphoinositide binding Phox Homolog 99.81
cd06892141 PX_SNX5_like The phosphoinositide binding Phox Hom 99.81
cd06862125 PX_SNX9_18_like The phosphoinositide binding Phox 99.8
cd07287118 PX_RPK118_like The phosphoinositide binding Phox H 99.8
cd06881117 PX_SNX15_like The phosphoinositide binding Phox Ho 99.8
cd06877119 PX_SNX14 The phosphoinositide binding Phox Homolog 99.8
cd06859114 PX_SNX1_2_like The phosphoinositide binding Phox H 99.79
cd07280120 PX_YPT35 The phosphoinositide binding Phox Homolog 99.79
cd07292141 PX_SNX6 The phosphoinositide binding Phox Homology 99.79
cd06879138 PX_UP1_plant The phosphoinositide binding Phox Hom 99.78
cd07301112 PX_SNX21 The phosphoinositide binding Phox Homolog 99.78
cd07276110 PX_SNX16 The phosphoinositide binding Phox Homolog 99.77
cd06897108 PX_SNARE The phosphoinositide binding Phox Homolog 99.77
cd07279112 PX_SNX20_21_like The phosphoinositide binding Phox 99.77
cd07300114 PX_SNX20 The phosphoinositide binding Phox Homolog 99.76
cd07291141 PX_SNX5 The phosphoinositide binding Phox Homology 99.76
cd07277118 PX_RUN The phosphoinositide binding Phox Homology 99.75
cd06872107 PX_SNX19_like_plant The phosphoinositide binding P 99.74
cd06873120 PX_SNX13 The phosphoinositide binding Phox Homolog 99.74
cd06870109 PX_CISK The phosphoinositide binding Phox Homology 99.74
cd06886106 PX_SNX27 The phosphoinositide binding Phox Homolog 99.74
cd06875116 PX_IRAS The phosphoinositide binding Phox Homology 99.71
cd06893132 PX_SNX19 The phosphoinositide binding Phox Homolog 99.71
cd06874127 PX_KIF16B_SNX23 The phosphoinositide binding Phox 99.7
cd06876133 PX_MDM1p The phosphoinositide binding Phox Homolog 99.7
smart00312105 PX PhoX homologous domain, present in p47phox and 99.7
cd06878127 PX_SNX25 The phosphoinositide binding Phox Homolog 99.69
cd06885104 PX_SNX17_31 The phosphoinositide binding Phox Homo 99.69
cd06880110 PX_SNX22 The phosphoinositide binding Phox Homolog 99.69
cd06883109 PX_PI3K_C2 The phosphoinositide binding Phox Homol 99.67
cd06882123 PX_p40phox The phosphoinositide binding Phox Homol 99.65
cd06871120 PX_MONaKA The phosphoinositide binding Phox Homolo 99.64
cd06869119 PX_UP2_fungi The phosphoinositide binding Phox Hom 99.62
cd06884111 PX_PI3K_C2_68D The phosphoinositide binding Phox H 99.61
cd06093106 PX_domain The Phox Homology domain, a phosphoinosi 99.61
KOG2273|consensus 503 99.59
PF00787113 PX: PX domain; InterPro: IPR001683 The PX (phox) d 99.57
KOG2528|consensus 490 99.55
cd06887118 PX_p47phox The phosphoinositide binding Phox Homol 99.52
COG5391 524 Phox homology (PX) domain protein [Intracellular t 99.5
cd06888119 PX_FISH The phosphoinositide binding Phox Homology 99.47
cd07290109 PX_PI3K_C2_beta The phosphoinositide binding Phox 99.46
cd07289109 PX_PI3K_C2_alpha The phosphoinositide binding Phox 99.44
cd06890112 PX_Bem1p The phosphoinositide binding Phox Homolog 99.43
cd06895140 PX_PLD The phosphoinositide binding Phox Homology 99.39
cd07296135 PX_PLD1 The phosphoinositide binding Phox Homology 99.17
KOG1259|consensus 490 98.98
cd06889121 PX_NoxO1 The phosphoinositide binding Phox Homolog 98.86
cd06896101 PX_PI3K_C2_gamma The phosphoinositide binding Phox 98.7
KOG2101|consensus 362 98.2
cd07297130 PX_PLD2 The phosphoinositide binding Phox Homology 98.16
KOG3784|consensus 407 97.96
KOG0905|consensus 1639 96.58
KOG1660|consensus 399 96.51
KOG4773|consensus 386 96.5
cd07298115 PX_RICS The phosphoinositide binding Phox Homology 95.36
>cd07283 PX_SNX30 The phosphoinositide binding Phox Homology domain of Sorting Nexin 30 Back     alignment and domain information
Probab=99.89  E-value=3.2e-23  Score=131.75  Aligned_cols=71  Identities=28%  Similarity=0.388  Sum_probs=60.1

Q ss_pred             ecccccCCCCC-ceeeecccchHHHHHHHHHHHCCCCCCCCCCCCCccccccccCCCCCCCCHHHHHHHHHHHHHhhC
Q psy12925          7 EDWSLIPKQNK-LSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLEVIDY   83 (83)
Q Consensus         7 ~~~~~~p~~~k-~~~V~RRYSdF~~L~~~L~~~~p~~~iPplP~K~~~~~~~~~~~~~~~~~~~fie~Rr~~Le~fL~   83 (83)
                      +.-++.|.+.+ ++.|+||||||+||++.|...+|++++||||+|+.+...      .++++++|||+||++||.||+
T Consensus        24 ~t~t~~~~~~~~~~~V~RRYsDF~~L~~~L~~~~p~~~iPpLP~K~~~~~~------~~~~~~~fie~Rr~~Le~FL~   95 (116)
T cd07283          24 TTKTTRTEFDLPEYSVRRRYQDFDWLRNKLEESQPTHLIPPLPEKFVVKGV------VDRFSEEFVETRRKALDKFLK   95 (116)
T ss_pred             EEecCCCCcccCceEEeCCccHHHHHHHHHHHhCCCcccCCCCCccccccc------ccCCCHHHHHHHHHHHHHHHH
Confidence            33455677764 799999999999999999999999999999999876321      356899999999999999985



The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. Some SNXs are localized in early endosome structures such as clathrin-coated pits, while others are located in late structures of the endocytic pathway. SNX30 harbors a Bin/Amphiphysin/Rvs (BAR) domain, which detects membrane curvature, C-terminal to the PX domain, similar to the sorting nexins SNX1-2, SNX4-8, and SNX32

>cd07284 PX_SNX7 The phosphoinositide binding Phox Homology domain of Sorting Nexin 7 Back     alignment and domain information
>cd07282 PX_SNX2 The phosphoinositide binding Phox Homology domain of Sorting Nexin 2 Back     alignment and domain information
>cd07286 PX_SNX18 The phosphoinositide binding Phox Homology domain of Sorting Nexin 18 Back     alignment and domain information
>cd06864 PX_SNX4 The phosphoinositide binding Phox Homology domain of Sorting Nexin 4 Back     alignment and domain information
>cd07293 PX_SNX3 The phosphoinositide binding Phox Homology domain of Sorting Nexin 3 Back     alignment and domain information
>cd06860 PX_SNX7_30_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 7 and 30 Back     alignment and domain information
>cd06863 PX_Atg24p The phosphoinositide binding Phox Homology domain of yeast Atg24p, an autophagic degradation protein Back     alignment and domain information
>cd06894 PX_SNX3_like The phosphoinositide binding Phox Homology domain of Sorting Nexin 3 and related proteins Back     alignment and domain information
>cd06861 PX_Vps5p The phosphoinositide binding Phox Homology domain of yeast sorting nexin Vps5p Back     alignment and domain information
>cd07285 PX_SNX9 The phosphoinositide binding Phox Homology domain of Sorting Nexin 9 Back     alignment and domain information
>cd07295 PX_Grd19 The phosphoinositide binding Phox Homology domain of fungal Grd19 Back     alignment and domain information
>cd06865 PX_SNX_like The phosphoinositide binding Phox Homology domain of SNX-like proteins Back     alignment and domain information
>cd07294 PX_SNX12 The phosphoinositide binding Phox Homology domain of Sorting Nexin 12 Back     alignment and domain information
>cd07281 PX_SNX1 The phosphoinositide binding Phox Homology domain of Sorting Nexin 1 Back     alignment and domain information
>cd06867 PX_SNX41_42 The phosphoinositide binding Phox Homology domain of fungal Sorting Nexins 41 and 42 Back     alignment and domain information
>cd06891 PX_Vps17p The phosphoinositide binding Phox Homology domain of yeast sorting nexin Vps17p Back     alignment and domain information
>KOG2527|consensus Back     alignment and domain information
>cd06868 PX_HS1BP3 The phosphoinositide binding Phox Homology domain of HS1BP3 Back     alignment and domain information
>cd06866 PX_SNX8_Mvp1p_like The phosphoinositide binding Phox Homology domain of Sorting Nexin 8 and yeast Mvp1p Back     alignment and domain information
>cd06898 PX_SNX10 The phosphoinositide binding Phox Homology domain of Sorting Nexin 10 Back     alignment and domain information
>cd07288 PX_SNX15 The phosphoinositide binding Phox Homology domain of Sorting Nexin 15 Back     alignment and domain information
>cd06892 PX_SNX5_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 5 and 6 Back     alignment and domain information
>cd06862 PX_SNX9_18_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 9 and 18 Back     alignment and domain information
>cd07287 PX_RPK118_like The phosphoinositide binding Phox Homology domain of RPK118-like proteins Back     alignment and domain information
>cd06881 PX_SNX15_like The phosphoinositide binding Phox Homology domain of Sorting Nexin 15-like proteins Back     alignment and domain information
>cd06877 PX_SNX14 The phosphoinositide binding Phox Homology domain of Sorting Nexin 14 Back     alignment and domain information
>cd06859 PX_SNX1_2_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 1 and 2 Back     alignment and domain information
>cd07280 PX_YPT35 The phosphoinositide binding Phox Homology domain of the fungal protein YPT35 Back     alignment and domain information
>cd07292 PX_SNX6 The phosphoinositide binding Phox Homology domain of Sorting Nexin 6 Back     alignment and domain information
>cd06879 PX_UP1_plant The phosphoinositide binding Phox Homology domain of uncharacterized plant proteins Back     alignment and domain information
>cd07301 PX_SNX21 The phosphoinositide binding Phox Homology domain of Sorting Nexin 21 Back     alignment and domain information
>cd07276 PX_SNX16 The phosphoinositide binding Phox Homology domain of Sorting Nexin 16 Back     alignment and domain information
>cd06897 PX_SNARE The phosphoinositide binding Phox Homology domain of SNARE proteins from fungi Back     alignment and domain information
>cd07279 PX_SNX20_21_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 20 and 21 Back     alignment and domain information
>cd07300 PX_SNX20 The phosphoinositide binding Phox Homology domain of Sorting Nexin 20 Back     alignment and domain information
>cd07291 PX_SNX5 The phosphoinositide binding Phox Homology domain of Sorting Nexin 5 Back     alignment and domain information
>cd07277 PX_RUN The phosphoinositide binding Phox Homology domain of uncharacterized proteins containing PX and RUN domains Back     alignment and domain information
>cd06872 PX_SNX19_like_plant The phosphoinositide binding Phox Homology domain of uncharacterized SNX19-like plant proteins Back     alignment and domain information
>cd06873 PX_SNX13 The phosphoinositide binding Phox Homology domain of Sorting Nexin 13 Back     alignment and domain information
>cd06870 PX_CISK The phosphoinositide binding Phox Homology Domain of Cytokine-Independent Survival Kinase Back     alignment and domain information
>cd06886 PX_SNX27 The phosphoinositide binding Phox Homology domain of Sorting Nexin 27 Back     alignment and domain information
>cd06875 PX_IRAS The phosphoinositide binding Phox Homology domain of the Imidazoline Receptor Antisera-Selected Back     alignment and domain information
>cd06893 PX_SNX19 The phosphoinositide binding Phox Homology domain of Sorting Nexin 19 Back     alignment and domain information
>cd06874 PX_KIF16B_SNX23 The phosphoinositide binding Phox Homology domain of KIF16B kinesin or Sorting Nexin 23 Back     alignment and domain information
>cd06876 PX_MDM1p The phosphoinositide binding Phox Homology domain of yeast MDM1p Back     alignment and domain information
>smart00312 PX PhoX homologous domain, present in p47phox and p40phox Back     alignment and domain information
>cd06878 PX_SNX25 The phosphoinositide binding Phox Homology domain of Sorting Nexin 25 Back     alignment and domain information
>cd06885 PX_SNX17_31 The phosphoinositide binding Phox Homology domain of Sorting Nexins 17 and 31 Back     alignment and domain information
>cd06880 PX_SNX22 The phosphoinositide binding Phox Homology domain of Sorting Nexin 22 Back     alignment and domain information
>cd06883 PX_PI3K_C2 The phosphoinositide binding Phox Homology Domain of Class II Phosphoinositide 3-Kinases Back     alignment and domain information
>cd06882 PX_p40phox The phosphoinositide binding Phox Homology domain of the p40phox subunit of NADPH oxidase Back     alignment and domain information
>cd06871 PX_MONaKA The phosphoinositide binding Phox Homology domain of Modulator of Na,K-ATPase Back     alignment and domain information
>cd06869 PX_UP2_fungi The phosphoinositide binding Phox Homology domain of uncharacterized fungal proteins Back     alignment and domain information
>cd06884 PX_PI3K_C2_68D The phosphoinositide binding Phox Homology Domain of Class II Phosphoinositide 3-Kinases similar to the Drosophila PI3K_68D protein Back     alignment and domain information
>cd06093 PX_domain The Phox Homology domain, a phosphoinositide binding module Back     alignment and domain information
>KOG2273|consensus Back     alignment and domain information
>PF00787 PX: PX domain; InterPro: IPR001683 The PX (phox) domain [] occurs in a variety of eukaryotic proteins and have been implicated in highly diverse functions such as cell signalling, vesicular trafficking, protein sorting and lipid modification [, , ] Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>cd06887 PX_p47phox The phosphoinositide binding Phox Homology domain of the p47phox subunit of NADPH oxidase Back     alignment and domain information
>COG5391 Phox homology (PX) domain protein [Intracellular trafficking and secretion / General function prediction only] Back     alignment and domain information
>cd06888 PX_FISH The phosphoinositide binding Phox Homology domain of Five SH protein Back     alignment and domain information
>cd07290 PX_PI3K_C2_beta The phosphoinositide binding Phox Homology Domain of the Beta Isoform of Class II Phosphoinositide 3-Kinases Back     alignment and domain information
>cd07289 PX_PI3K_C2_alpha The phosphoinositide binding Phox Homology Domain of the Alpha Isoform of Class II Phosphoinositide 3-Kinases Back     alignment and domain information
>cd06890 PX_Bem1p The phosphoinositide binding Phox Homology domain of Bem1p Back     alignment and domain information
>cd06895 PX_PLD The phosphoinositide binding Phox Homology domain of Phospholipase D Back     alignment and domain information
>cd07296 PX_PLD1 The phosphoinositide binding Phox Homology domain of Phospholipase D1 Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>cd06889 PX_NoxO1 The phosphoinositide binding Phox Homology domain of Nox Organizing protein 1 Back     alignment and domain information
>cd06896 PX_PI3K_C2_gamma The phosphoinositide binding Phox Homology Domain of the Gamma Isoform of Class II Phosphoinositide 3-Kinases Back     alignment and domain information
>KOG2101|consensus Back     alignment and domain information
>cd07297 PX_PLD2 The phosphoinositide binding Phox Homology domain of Phospholipase D2 Back     alignment and domain information
>KOG3784|consensus Back     alignment and domain information
>KOG0905|consensus Back     alignment and domain information
>KOG1660|consensus Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>cd07298 PX_RICS The phosphoinositide binding Phox Homology domain of PX-RICS Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query83
3iq2_A138 Human Sorting Nexin 7, Phox Homology (Px) Domain Le 8e-04
>pdb|3IQ2|A Chain A, Human Sorting Nexin 7, Phox Homology (Px) Domain Length = 138 Back     alignment and structure

Iteration: 1

Score = 38.9 bits (89), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 6/58 (10%) Query: 21 VWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASL 78 V RRY +F +K L+ +P +I+PPLPEK F+ K + + DF++ RR +L Sbjct: 47 VRRRYQDFLWLKGKLEEAHPTLIIPPLPEK---FIVK---GMVERFNDDFIETRRKAL 98

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query83
2i4k_A128 Sorting nexin-1, SNX1; 3-stranded beta sheet, 3 al 2e-16
3iq2_A138 Sorting nexin-7; SNX7, PHOX, protein signalling, S 6e-16
2csk_A146 Sorting nexin 12; SNX12, PX domain, structural gen 6e-16
1kmd_A117 VAM7P, vacuolar morphogenesis protein VAM7; PX dom 9e-15
3lui_A115 Sorting nexin-17, SNX17; PX domain, endosome, phos 2e-14
4akv_A 386 Sorting nexin-33; transport protein, organelle bio 6e-14
3dyt_A 366 Sorting nexin-9; 3-helix bundle, BAR domain, PX do 3e-12
1ocs_A162 Sorting nexin GRD19; sorting protein, PX-domain, y 4e-12
1xte_A154 Serine/threonine-protein kinase SGK3; CISK, PX dom 5e-12
2v14_A134 Kinesin-like motor protein C20ORF23; plus-END kine 7e-11
3p0c_A130 Nischarin; structural genomics, structural genomic 3e-10
2ett_A128 Sorting nexin-22; PX domain, BC019655, SNX22_human 6e-08
3hpc_X161 SNX5 protein; sprting nexin, PHOX, SNX5-PX, phosph 2e-07
2ar5_A121 Phosphoinositide 3-kinase; PX domain, transferase; 2e-07
2iwl_X140 Phosphatidylinositol-4-phosphate 3-kinase C2 domai 8e-07
2wwe_A127 Phosphoinositide-3-kinase, class 2, gamma polypept 3e-06
1kq6_A141 NCF-1, P47PHOX, neutrophil cytosol factor 1; alpha 1e-05
2l73_A149 NADPH oxidase organizer 1; cell membrane, PX domai 3e-04
1h6h_A143 Neutrophil cytosol factor 4; PX domain; HET: PIB; 6e-04
>2i4k_A Sorting nexin-1, SNX1; 3-stranded beta sheet, 3 alpha helices, proline rich loop, protein transport; NMR {Homo sapiens} Length = 128 Back     alignment and structure
 Score = 67.6 bits (165), Expect = 2e-16
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 15  QNKLSIVWRRYSEFEQMKNYLQATYPY--VILPPLPEKKPTFVWKHDAASTDITDPDFVD 72
           ++K   V RR+S+F  +   L   +     I+PP PEK    + K      D +  +F++
Sbjct: 36  RSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLE 95

Query: 73  RRRASLEV 80
           +RRA+LE 
Sbjct: 96  KRRAALER 103


>3iq2_A Sorting nexin-7; SNX7, PHOX, protein signalling, SGC, structur genomics consortium, protein transport, transport; 1.70A {Homo sapiens} Length = 138 Back     alignment and structure
>2csk_A Sorting nexin 12; SNX12, PX domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 146 Back     alignment and structure
>1kmd_A VAM7P, vacuolar morphogenesis protein VAM7; PX domain, phosphoinositide binding, endocytosis/exocytosis complex; NMR {Saccharomyces cerevisiae} SCOP: d.189.1.1 Length = 117 Back     alignment and structure
>3lui_A Sorting nexin-17, SNX17; PX domain, endosome, phosphoprotein, P transport, transport; 1.80A {Homo sapiens} PDB: 3fog_A Length = 115 Back     alignment and structure
>4akv_A Sorting nexin-33; transport protein, organelle biogenesis; 2.65A {Homo sapiens} Length = 386 Back     alignment and structure
>3dyt_A Sorting nexin-9; 3-helix bundle, BAR domain, PX domain, phosphoprotein, protein transport, SH3 domain, transport, transport protein; 2.08A {Homo sapiens} PDB: 3dyu_A 2raj_A 2rai_A 2rak_A* Length = 366 Back     alignment and structure
>1ocs_A Sorting nexin GRD19; sorting protein, PX-domain, yeast protein; HET: CME; 2.03A {Saccharomyces cerevisiae} SCOP: d.189.1.1 PDB: 1ocu_A* Length = 162 Back     alignment and structure
>1xte_A Serine/threonine-protein kinase SGK3; CISK, PX domain, transferase; 1.60A {Mus musculus} SCOP: d.189.1.1 PDB: 1xtn_A Length = 154 Back     alignment and structure
>2v14_A Kinesin-like motor protein C20ORF23; plus-END kinesin complex, transport protein, phosphatidylinositol 3-phosphate binding, nucleotide-binding; 2.20A {Homo sapiens} Length = 134 Back     alignment and structure
>3p0c_A Nischarin; structural genomics, structural genomics consortium, SGC, PX signaling protein; 2.27A {Homo sapiens} Length = 130 Back     alignment and structure
>2ett_A Sorting nexin-22; PX domain, BC019655, SNX22_human, HS.157607, structural genomics,protein structure initiative PSI; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>3hpc_X SNX5 protein; sprting nexin, PHOX, SNX5-PX, phosphatidylinositol, PI(4,5)P2, cell adhesion, protein transport; 1.47A {Rattus norvegicus} PDB: 3hpb_A Length = 161 Back     alignment and structure
>2ar5_A Phosphoinositide 3-kinase; PX domain, transferase; 1.80A {Homo sapiens} PDB: 2rea_A 2red_A Length = 121 Back     alignment and structure
>2iwl_X Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing alpha polypeptide; PI3K, PX domain, transferase; 2.6A {Homo sapiens} Length = 140 Back     alignment and structure
>2wwe_A Phosphoinositide-3-kinase, class 2, gamma polypeptide; phosphoprotein, nucleotide-binding, PIK3C2G, membrane, PX-domain, transferase, ATP-binding; 1.25A {Homo sapiens} Length = 127 Back     alignment and structure
>1kq6_A NCF-1, P47PHOX, neutrophil cytosol factor 1; alpha beta, PX domain, NADPH oxidase, protein binding; HET: MSE; 1.18A {Homo sapiens} SCOP: d.189.1.1 PDB: 1gd5_A 1o7k_A Length = 141 Back     alignment and structure
>2l73_A NADPH oxidase organizer 1; cell membrane, PX domain, oxidoreductase regulator; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>1h6h_A Neutrophil cytosol factor 4; PX domain; HET: PIB; 1.7A {Homo sapiens} SCOP: d.189.1.1 Length = 143 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query83
3iq2_A138 Sorting nexin-7; SNX7, PHOX, protein signalling, S 99.86
1ocs_A162 Sorting nexin GRD19; sorting protein, PX-domain, y 99.84
2i4k_A128 Sorting nexin-1, SNX1; 3-stranded beta sheet, 3 al 99.83
2csk_A146 Sorting nexin 12; SNX12, PX domain, structural gen 99.82
2v14_A134 Kinesin-like motor protein C20ORF23; plus-END kine 99.8
3lui_A115 Sorting nexin-17, SNX17; PX domain, endosome, phos 99.8
1kmd_A117 VAM7P, vacuolar morphogenesis protein VAM7; PX dom 99.79
3hpc_X161 SNX5 protein; sprting nexin, PHOX, SNX5-PX, phosph 99.79
2ar5_A121 Phosphoinositide 3-kinase; PX domain, transferase; 99.76
3dyt_A 366 Sorting nexin-9; 3-helix bundle, BAR domain, PX do 99.74
4akv_A 386 Sorting nexin-33; transport protein, organelle bio 99.74
3p0c_A130 Nischarin; structural genomics, structural genomic 99.74
1xte_A154 Serine/threonine-protein kinase SGK3; CISK, PX dom 99.74
1h6h_A143 Neutrophil cytosol factor 4; PX domain; HET: PIB; 99.73
2ett_A128 Sorting nexin-22; PX domain, BC019655, SNX22_human 99.72
4az9_A129 Sorting nexin-24; protein transport; 1.75A {Homo s 99.7
1kq6_A141 NCF-1, P47PHOX, neutrophil cytosol factor 1; alpha 99.69
2iwl_X140 Phosphatidylinositol-4-phosphate 3-kinase C2 domai 99.68
2v6v_A156 BUD emergence protein 1; homotypic fusion, regulat 99.6
2l73_A149 NADPH oxidase organizer 1; cell membrane, PX domai 99.54
2wwe_A127 Phosphoinositide-3-kinase, class 2, gamma polypept 99.35
2dyb_A 341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 99.25
>3iq2_A Sorting nexin-7; SNX7, PHOX, protein signalling, SGC, structur genomics consortium, protein transport, transport; 1.70A {Homo sapiens} Back     alignment and structure
Probab=99.86  E-value=2.7e-22  Score=129.24  Aligned_cols=69  Identities=29%  Similarity=0.368  Sum_probs=56.9

Q ss_pred             ccccCCCC-CceeeecccchHHHHHHHHHHHCCCCCCCCCCCCCccccccccCCCCCCCCHHHHHHHHHHHHHhhC
Q psy12925          9 WSLIPKQN-KLSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLEVIDY   83 (83)
Q Consensus         9 ~~~~p~~~-k~~~V~RRYSdF~~L~~~L~~~~p~~~iPplP~K~~~~~~~~~~~~~~~~~~~fie~Rr~~Le~fL~   83 (83)
                      -++.|.+. ++|.|+||||||.||++.|.+.||++.+||||+|..++.+      .++++++|||+||++||.||+
T Consensus        34 ~t~~~~f~~~~~~V~RRYsdF~~L~~~L~~~~p~~~iP~lP~K~~~~~~------~~~~~~~fie~Rr~~Le~fL~  103 (138)
T 3iq2_A           34 KTSRGEFDSSEFEVRRRYQDFLWLKGKLEEAHPTLIIPPLPEKFIVKGM------VERFNDDFIETRRKALHKFLN  103 (138)
T ss_dssp             ESCSSSSSCCEEEEEEEHHHHHHHHHHHHHHCTTSCCCCCCCCC----C------CGGGCHHHHHHHHHHHHHHHH
T ss_pred             EECCCCcCCCeEEEEcChHHHHHHHHHHHHHCcCcccCCCCcchhhccc------cccCCHHHHHHHHHHHHHHHH
Confidence            34556665 4799999999999999999999999999999999987421      246799999999999999985



>1ocs_A Sorting nexin GRD19; sorting protein, PX-domain, yeast protein; HET: CME; 2.03A {Saccharomyces cerevisiae} SCOP: d.189.1.1 PDB: 1ocu_A* Back     alignment and structure
>2i4k_A Sorting nexin-1, SNX1; 3-stranded beta sheet, 3 alpha helices, proline rich loop, protein transport; NMR {Homo sapiens} Back     alignment and structure
>2csk_A Sorting nexin 12; SNX12, PX domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2v14_A Kinesin-like motor protein C20ORF23; plus-END kinesin complex, transport protein, phosphatidylinositol 3-phosphate binding, nucleotide-binding; 2.20A {Homo sapiens} Back     alignment and structure
>3lui_A Sorting nexin-17, SNX17; PX domain, endosome, phosphoprotein, P transport, transport; 1.80A {Homo sapiens} PDB: 3fog_A Back     alignment and structure
>1kmd_A VAM7P, vacuolar morphogenesis protein VAM7; PX domain, phosphoinositide binding, endocytosis/exocytosis complex; NMR {Saccharomyces cerevisiae} SCOP: d.189.1.1 Back     alignment and structure
>3hpc_X SNX5 protein; sprting nexin, PHOX, SNX5-PX, phosphatidylinositol, PI(4,5)P2, cell adhesion, protein transport; 1.47A {Rattus norvegicus} PDB: 3hpb_A Back     alignment and structure
>2ar5_A Phosphoinositide 3-kinase; PX domain, transferase; 1.80A {Homo sapiens} PDB: 2rea_A 2red_A Back     alignment and structure
>3dyt_A Sorting nexin-9; 3-helix bundle, BAR domain, PX domain, phosphoprotein, protein transport, SH3 domain, transport, transport protein; 2.08A {Homo sapiens} PDB: 3dyu_A 2raj_A 2rai_A 2rak_A* Back     alignment and structure
>4akv_A Sorting nexin-33; transport protein, organelle biogenesis; 2.65A {Homo sapiens} Back     alignment and structure
>3p0c_A Nischarin; structural genomics, structural genomics consortium, SGC, PX signaling protein; 2.27A {Homo sapiens} Back     alignment and structure
>1xte_A Serine/threonine-protein kinase SGK3; CISK, PX domain, transferase; 1.60A {Mus musculus} SCOP: d.189.1.1 PDB: 1xtn_A Back     alignment and structure
>1h6h_A Neutrophil cytosol factor 4; PX domain; HET: PIB; 1.7A {Homo sapiens} SCOP: d.189.1.1 Back     alignment and structure
>2ett_A Sorting nexin-22; PX domain, BC019655, SNX22_human, HS.157607, structural genomics,protein structure initiative PSI; NMR {Homo sapiens} Back     alignment and structure
>4az9_A Sorting nexin-24; protein transport; 1.75A {Homo sapiens} Back     alignment and structure
>1kq6_A NCF-1, P47PHOX, neutrophil cytosol factor 1; alpha beta, PX domain, NADPH oxidase, protein binding; HET: MSE; 1.18A {Homo sapiens} SCOP: d.189.1.1 PDB: 1gd5_A 1o7k_A Back     alignment and structure
>2iwl_X Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing alpha polypeptide; PI3K, PX domain, transferase; 2.6A {Homo sapiens} Back     alignment and structure
>2v6v_A BUD emergence protein 1; homotypic fusion, regulator, PI3P, 3-kinase, PX domain, SH3 domain, cytoskeleton, cell polarity; 1.5A {Saccharomyces cerevisiae} PDB: 2czo_A Back     alignment and structure
>2l73_A NADPH oxidase organizer 1; cell membrane, PX domain, oxidoreductase regulator; NMR {Homo sapiens} Back     alignment and structure
>2wwe_A Phosphoinositide-3-kinase, class 2, gamma polypeptide; phosphoprotein, nucleotide-binding, PIK3C2G, membrane, PX-domain, transferase, ATP-binding; 1.25A {Homo sapiens} Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 83
d1kmda_117 d.189.1.1 (A:) Vam7p {Baker's yeast (Saccharomyces 3e-11
d1kq6a_140 d.189.1.1 (A:) p47phox NADPH oxidase {Human (Homo 4e-08
d1xtea_116 d.189.1.1 (A:) Serine/threonine-protein kinase Sgk 7e-07
d1ocsa_132 d.189.1.1 (A:) Sorting nexin grd19 {Baker's yeast 8e-07
d1h6ha_143 d.189.1.1 (A:) p40phox NADPH oxidase {Human (Homo 5e-04
>d1kmda_ d.189.1.1 (A:) Vam7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 117 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: PX domain
superfamily: PX domain
family: PX domain
domain: Vam7p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 52.7 bits (126), Expect = 3e-11
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 3/59 (5%)

Query: 21 VWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLE 79
          +++RYSEF ++K  L+      I    PEK      +         DP+ +D RR  LE
Sbjct: 31 LYKRYSEFWKLKTRLERDVGSTIPYDFPEKPGVLDRRW---QRRYDDPEMIDERRIGLE 86


>d1kq6a_ d.189.1.1 (A:) p47phox NADPH oxidase {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1xtea_ d.189.1.1 (A:) Serine/threonine-protein kinase Sgk3, Cisk {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 Back     information, alignment and structure
>d1ocsa_ d.189.1.1 (A:) Sorting nexin grd19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 132 Back     information, alignment and structure
>d1h6ha_ d.189.1.1 (A:) p40phox NADPH oxidase {Human (Homo sapiens) [TaxId: 9606]} Length = 143 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query83
d1kmda_117 Vam7p {Baker's yeast (Saccharomyces cerevisiae) [T 99.77
d1ocsa_132 Sorting nexin grd19 {Baker's yeast (Saccharomyces 99.76
d1xtea_116 Serine/threonine-protein kinase Sgk3, Cisk {Mouse 99.66
d1kq6a_140 p47phox NADPH oxidase {Human (Homo sapiens) [TaxId 99.63
d1h6ha_143 p40phox NADPH oxidase {Human (Homo sapiens) [TaxId 99.61
>d1kmda_ d.189.1.1 (A:) Vam7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: PX domain
superfamily: PX domain
family: PX domain
domain: Vam7p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.77  E-value=1.9e-19  Score=111.55  Aligned_cols=64  Identities=28%  Similarity=0.382  Sum_probs=56.3

Q ss_pred             CceeeecccchHHHHHHHHHHHCCCCCCCCCCCCCccccccccCCCCCCCCHHHHHHHHHHHHHhhC
Q psy12925         17 KLSIVWRRYSEFEQMKNYLQATYPYVILPPLPEKKPTFVWKHDAASTDITDPDFVDRRRASLEVIDY   83 (83)
Q Consensus        17 k~~~V~RRYSdF~~L~~~L~~~~p~~~iPplP~K~~~~~~~~~~~~~~~~~~~fie~Rr~~Le~fL~   83 (83)
                      +.+.|+||||||.+||+.|...||+..+||+|+|..++.+.   ...+++++++||+|+++||.||+
T Consensus        27 ~~~~V~RRYsdF~~L~~~L~~~~~~~~~p~lP~K~~~~~~~---~~~~~~~~~~ie~R~~~Le~yL~   90 (117)
T d1kmda_          27 PNKRLYKRYSEFWKLKTRLERDVGSTIPYDFPEKPGVLDRR---WQRRYDDPEMIDERRIGLERFLN   90 (117)
T ss_dssp             SSCCEEECHHHHHHHHHHHHHHHCSCCCCCCCCCCCSSCST---TCCCTTCHHHHHHHHTTHHHHHH
T ss_pred             CCEEEEehHHHHHHHHHHHHHHCCCCcCCCCCccccccccc---cccCCCCHHHHHHHHHHHHHHHH
Confidence            47899999999999999999999999999999999875332   22577899999999999999984



>d1ocsa_ d.189.1.1 (A:) Sorting nexin grd19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtea_ d.189.1.1 (A:) Serine/threonine-protein kinase Sgk3, Cisk {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kq6a_ d.189.1.1 (A:) p47phox NADPH oxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ha_ d.189.1.1 (A:) p40phox NADPH oxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure