Diaphorina citri psyllid: psy12929


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MKNHIGGIKKATSGSIFYGNACVGMILFIRLARRWPALVRDWQLVETSMSRFGTPRLGWRFTVMSSVLFSLAFVEHGLHNWLNTRPGGKDDISSMSMRGGAKVGANFSIDNSLTFAGAGKPPVGLHLDVLKEDKLVQKLMLDEKKCYLFGRNKDLCDICIDHQSCSRVHAAFVYHTALERAFLVDLGSILPRELYGVT
ccccccCEEEEEEEEEEEHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccEEEEEEEEccccEEEECcccccccEEccccccccccEEEEEEccccEEEEEEccccccccccccc
*******IKKATSGSIFYGNACVGMILFIRLARRWPALVRDWQLVETSMSRFGTPRLGWRFTVMSSVLFSLAFVEHGLHNWLNT*******************GANFSIDNSLTFAGAGKPPVGLHLDVLKEDKLVQKLMLDEKKCYLFGRNKDLCDICIDHQSCSRVHAAFVYHTALERAFLVDLGSILPRELYGV*
xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNHIGGIKKATSGSIFYGNACVGMILFIRLARRWPALVRDWQLVETSMSRFGTPRLGWRFTVMSSVLFSLAFVEHGLHNWLNTRPGGKDDISSMSMRGGAKVGANFSIDNSLTFAGAGKPPVGLHLDVLKEDKLVQKLMLDEKKCYLFGRNKDLCDICIDHQSCSRVHAAFVYHTALERAFLVDLGSILPRELYGVT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nuclear inhibitor of protein phosphatase 1 Isoform Gamma is a site-specific single-strand endoribonuclease that cleaves single strand RNA 3' to purines and pyrimidines in A+U-rich regions. It generates 5'-phosphate termini at the site of cleavage. This isoform does not inhibit PP-1. May be implicated in mRNA splicing.confidentQ12972
Nuclear inhibitor of protein phosphatase 1 Inhibitor subunit of the major nuclear protein phosphatase-1 (PP-1). It has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates. May also be involved in pre-mRNA splicing. Binds DNA and might act as a transcriptional repressor. Seems to be required for cell proliferation.confidentQ28147

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016607 [CC]nuclear speckprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ELV, chain A
Confidence level:very confident
Coverage over the Query: 106-198
View the alignment between query and template
View the model in PyMOL