Psyllid ID: psy12929
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 198 | ||||||
| 242010356 | 338 | nuclear inhibitor of protein phosphatase | 0.358 | 0.210 | 0.873 | 2e-29 | |
| 193610474 | 342 | PREDICTED: nuclear inhibitor of protein | 0.358 | 0.207 | 0.845 | 7e-29 | |
| 307186748 | 344 | Nuclear inhibitor of protein phosphatase | 0.358 | 0.206 | 0.830 | 2e-28 | |
| 307198155 | 343 | Nuclear inhibitor of protein phosphatase | 0.358 | 0.206 | 0.830 | 3e-28 | |
| 332018085 | 342 | Nuclear inhibitor of protein phosphatase | 0.358 | 0.207 | 0.830 | 3e-28 | |
| 328783348 | 343 | PREDICTED: nuclear inhibitor of protein | 0.358 | 0.206 | 0.830 | 3e-28 | |
| 380016302 | 343 | PREDICTED: nuclear inhibitor of protein | 0.358 | 0.206 | 0.830 | 3e-28 | |
| 340725410 | 365 | PREDICTED: nuclear inhibitor of protein | 0.358 | 0.194 | 0.830 | 3e-28 | |
| 383860924 | 343 | PREDICTED: nuclear inhibitor of protein | 0.358 | 0.206 | 0.830 | 3e-28 | |
| 350403924 | 365 | PREDICTED: nuclear inhibitor of protein | 0.358 | 0.194 | 0.830 | 4e-28 |
| >gi|242010356|ref|XP_002425934.1| nuclear inhibitor of protein phosphatase-1, putative [Pediculus humanus corporis] gi|212509917|gb|EEB13196.1| nuclear inhibitor of protein phosphatase-1, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 134 bits (337), Expect = 2e-29, Method: Compositional matrix adjust.
Identities = 62/71 (87%), Positives = 63/71 (88%)
Query: 118 AGKPPVGLHLDVLKEDKLVQKLMLDEKKCYLFGRNKDLCDICIDHQSCSRVHAAFVYHTA 177
AGKPPVGLHLDVLK DKL+QKLMLDEKKCYLFGRN L D CIDHQSCSRVHAAFVYH
Sbjct: 11 AGKPPVGLHLDVLKGDKLIQKLMLDEKKCYLFGRNPQLNDFCIDHQSCSRVHAAFVYHKH 70
Query: 178 LERAFLVDLGS 188
L RAFLVDLGS
Sbjct: 71 LNRAFLVDLGS 81
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|193610474|ref|XP_001943542.1| PREDICTED: nuclear inhibitor of protein phosphatase 1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|307186748|gb|EFN72193.1| Nuclear inhibitor of protein phosphatase 1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307198155|gb|EFN79176.1| Nuclear inhibitor of protein phosphatase 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332018085|gb|EGI58699.1| Nuclear inhibitor of protein phosphatase 1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|328783348|ref|XP_003250277.1| PREDICTED: nuclear inhibitor of protein phosphatase 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380016302|ref|XP_003692126.1| PREDICTED: nuclear inhibitor of protein phosphatase 1-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340725410|ref|XP_003401063.1| PREDICTED: nuclear inhibitor of protein phosphatase 1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|383860924|ref|XP_003705937.1| PREDICTED: nuclear inhibitor of protein phosphatase 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|350403924|ref|XP_003486952.1| PREDICTED: nuclear inhibitor of protein phosphatase 1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 198 | ||||||
| FB|FBgn0026402 | 383 | NiPp1 "Nuclear inhibitor of Pr | 0.358 | 0.185 | 0.774 | 1.2e-26 | |
| UNIPROTKB|A4FUE1 | 351 | PPP1R8 "Protein phosphatase 1, | 0.454 | 0.256 | 0.619 | 6.6e-26 | |
| UNIPROTKB|Q28147 | 351 | PPP1R8 "Nuclear inhibitor of p | 0.454 | 0.256 | 0.619 | 6.6e-26 | |
| UNIPROTKB|Q12972 | 351 | PPP1R8 "Nuclear inhibitor of p | 0.454 | 0.256 | 0.619 | 6.6e-26 | |
| UNIPROTKB|I3LFB1 | 350 | PPP1R8 "Uncharacterized protei | 0.454 | 0.257 | 0.619 | 6.6e-26 | |
| UNIPROTKB|F1N9I1 | 352 | PPP1R8 "Uncharacterized protei | 0.358 | 0.201 | 0.746 | 1.8e-25 | |
| MGI|MGI:2140494 | 351 | Ppp1r8 "protein phosphatase 1, | 0.358 | 0.202 | 0.746 | 1.8e-25 | |
| RGD|1306280 | 351 | Ppp1r8 "protein phosphatase 1, | 0.358 | 0.202 | 0.746 | 1.8e-25 | |
| ZFIN|ZDB-GENE-040426-1271 | 349 | zgc:63827 "zgc:63827" [Danio r | 0.358 | 0.203 | 0.746 | 1.8e-25 | |
| DICTYBASE|DDB_G0268618 | 268 | pinA "Peptidyl-prolyl cis-tran | 0.358 | 0.264 | 0.366 | 6.6e-08 |
| FB|FBgn0026402 NiPp1 "Nuclear inhibitor of Protein phosphatase 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 300 (110.7 bits), Expect = 1.2e-26, P = 1.2e-26
Identities = 55/71 (77%), Positives = 61/71 (85%)
Query: 118 AGKPPVGLHLDVLKEDKLVQKLMLDEKKCYLFGRNKDLCDICIDHQSCSRVHAAFVYHTA 177
AGKPP GLHLDVLK+DKLVQKLM+DEK+CYLFGRN + D CIDH SCSRVH+AFVYH
Sbjct: 11 AGKPPTGLHLDVLKDDKLVQKLMVDEKRCYLFGRNSQMNDFCIDHASCSRVHSAFVYHKH 70
Query: 178 LERAFLVDLGS 188
L A+LVDLGS
Sbjct: 71 LNIAYLVDLGS 81
|
|
| UNIPROTKB|A4FUE1 PPP1R8 "Protein phosphatase 1, regulatory (Inhibitor) subunit 8" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q28147 PPP1R8 "Nuclear inhibitor of protein phosphatase 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q12972 PPP1R8 "Nuclear inhibitor of protein phosphatase 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LFB1 PPP1R8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N9I1 PPP1R8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2140494 Ppp1r8 "protein phosphatase 1, regulatory (inhibitor) subunit 8" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1306280 Ppp1r8 "protein phosphatase 1, regulatory subunit 8" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1271 zgc:63827 "zgc:63827" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0268618 pinA "Peptidyl-prolyl cis-trans isomerase ESS1" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 198 | |||
| cd00060 | 102 | cd00060, FHA, Forkhead associated domain (FHA); fo | 2e-13 | |
| pfam06151 | 414 | pfam06151, Trehalose_recp, Trehalose receptor | 1e-08 | |
| pfam00498 | 67 | pfam00498, FHA, FHA domain | 2e-07 | |
| smart00240 | 52 | smart00240, FHA, Forkhead associated domain | 6e-07 |
| >gnl|CDD|238017 cd00060, FHA, Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
Score = 63.2 bits (154), Expect = 2e-13
Identities = 25/64 (39%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
Query: 125 LHLDVLKEDKLVQKLMLDEKKCYLFGRNKDLCDICIDHQSCSRVHAAFVYHTALERAFLV 184
L VL D ++ LD Y GR+ D CDI +D S SR HA Y L+
Sbjct: 2 PRLVVLSGDASGRRYYLDPGGTYTIGRDSDNCDIVLDDPSVSRRHAVIRYD-GDGGVVLI 60
Query: 185 DLGS 188
DLGS
Sbjct: 61 DLGS 64
|
Putative nuclear signalling domain. FHA domains may bind phosphothreonine, phosphoserine and sometimes phosphotyrosine. In eukaryotes, many FHA domain-containing proteins localize to the nucleus, where they participate in establishing or maintaining cell cycle checkpoints, DNA repair, or transcriptional regulation. Members of the FHA family include: Dun1, Rad53, Cds1, Mek1, KAPP(kinase-associated protein phosphatase),and Ki-67 (a human nuclear protein related to cell proliferation). Length = 102 |
| >gnl|CDD|218913 pfam06151, Trehalose_recp, Trehalose receptor | Back alignment and domain information |
|---|
| >gnl|CDD|215951 pfam00498, FHA, FHA domain | Back alignment and domain information |
|---|
| >gnl|CDD|214578 smart00240, FHA, Forkhead associated domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| KOG1882|consensus | 293 | 99.84 | ||
| PF06151 | 414 | Trehalose_recp: Trehalose receptor; InterPro: IPR0 | 99.77 | |
| KOG1881|consensus | 793 | 99.65 | ||
| PF00498 | 68 | FHA: FHA domain; InterPro: IPR000253 The forkhead- | 99.63 | |
| KOG1880|consensus | 337 | 99.51 | ||
| smart00240 | 52 | FHA Forkhead associated domain. Found in eukaryoti | 99.5 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 99.41 | |
| cd00060 | 102 | FHA Forkhead associated domain (FHA); found in euk | 99.41 | |
| COG1716 | 191 | FOG: FHA domain [Signal transduction mechanisms] | 99.24 | |
| TIGR03354 | 396 | VI_FHA type VI secretion system FHA domain protein | 99.2 | |
| COG3456 | 430 | Predicted component of the type VI protein secreti | 98.57 | |
| TIGR02500 | 410 | type_III_yscD type III secretion apparatus protein | 97.88 | |
| KOG0615|consensus | 475 | 97.29 | ||
| KOG0245|consensus | 1221 | 80.63 |
| >KOG1882|consensus | Back alignment and domain information |
|---|
Probab=99.84 E-value=1.1e-21 Score=164.24 Aligned_cols=90 Identities=31% Similarity=0.489 Sum_probs=82.3
Q ss_pred cccccccCCCcCccCCCCCCCceEEEEEeCCceeeEEEecCcceEEeccCCCCcceEeCCCCcCccceEEEEEccC----
Q psy12929 103 VGANFSIDNSLTFAGAGKPPVGLHLDVLKEDKLVQKLMLDEKKCYLFGRNKDLCDICIDHQSCSRVHAAFVYHTAL---- 178 (198)
Q Consensus 103 ~~~~y~eP~~~~~~~a~~p~~~~~L~v~~~~~~~~~~~l~~~~~~~iGR~~~~~di~l~~~~vSr~Ha~i~~~~~~---- 178 (198)
+.++|.+|+. +..|...|+|++++++..+++.-++..++|++||+...+||.++||+||+|||+|||+...
T Consensus 157 v~v~y~eppe-----arkP~kRwrLy~fk~~e~l~~l~iHrqs~yL~gRerkIaDi~idhpScSKQHaviQyR~v~~~r~ 231 (293)
T KOG1882|consen 157 VVVKYNEPPE-----ARKPKKRWRLYPFKCYEVLPVLYIHRQSCYLDGRERKIADIPIDHPSCSKQHAVIQYRLVEFTRA 231 (293)
T ss_pred EEEEecCCch-----hcCchhheecccccCCcccchheeeeeeeeecCceeeeeccCCCCccccccceeeeeeecccccC
Confidence 4678999999 9999999999999999988888899999999999987899999999999999999997532
Q ss_pred C-------eEEEEeCCCCCCeeecCc
Q psy12929 179 E-------RAFLVDLGSILPRELYGV 197 (198)
Q Consensus 179 ~-------~~~i~DL~StNGT~vNg~ 197 (198)
+ ++||+||||+||||+|.+
T Consensus 232 dGt~grrvkpYiiDLgS~NgTfLNnk 257 (293)
T KOG1882|consen 232 DGTVGRRVKPYIIDLGSGNGTFLNNK 257 (293)
T ss_pred CCccceeeeeEEEecCCCCcceecCc
Confidence 2 699999999999999975
|
|
| >PF06151 Trehalose_recp: Trehalose receptor; InterPro: IPR009318 In Drosophila, taste is perceived by gustatory neurons located in sensilla distributed on several different appendages throughout the body of the animal | Back alignment and domain information |
|---|
| >KOG1881|consensus | Back alignment and domain information |
|---|
| >PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins | Back alignment and domain information |
|---|
| >KOG1880|consensus | Back alignment and domain information |
|---|
| >smart00240 FHA Forkhead associated domain | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >cd00060 FHA Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >COG1716 FOG: FHA domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03354 VI_FHA type VI secretion system FHA domain protein | Back alignment and domain information |
|---|
| >COG3456 Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02500 type_III_yscD type III secretion apparatus protein, YscD/HrpQ family | Back alignment and domain information |
|---|
| >KOG0615|consensus | Back alignment and domain information |
|---|
| >KOG0245|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 198 | ||||
| 2jpe_A | 140 | Fha Domain Of Nipp1 Length = 140 | 1e-27 | ||
| 3vpy_A | 145 | Crystal Structure Of Arabidopsis Ddl Fha Domain Len | 3e-06 |
| >pdb|2JPE|A Chain A, Fha Domain Of Nipp1 Length = 140 | Back alignment and structure |
|
| >pdb|3VPY|A Chain A, Crystal Structure Of Arabidopsis Ddl Fha Domain Length = 145 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 198 | |||
| 2jpe_A | 140 | Nuclear inhibitor of protein phosphatase 1; FHA do | 6e-25 | |
| 3elv_A | 205 | PRE-mRNA leakage protein 1; intrinsically unstruct | 3e-11 | |
| 3gqs_A | 106 | Adenylate cyclase-like protein; FHA domain, struct | 4e-11 | |
| 3els_A | 158 | PRE-mRNA leakage protein 1; intrinsically unstruct | 1e-10 | |
| 3va4_A | 132 | Mediator of DNA damage checkpoint protein 1; cell | 2e-10 | |
| 1uht_A | 118 | Expressed protein; FHA domain, beta-sandwich, anti | 3e-08 | |
| 1r21_A | 128 | Antigen KI-67; beta sandwich, cell cycle; NMR {Hom | 1e-07 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 2e-07 | |
| 2kfu_A | 162 | RV1827 PThr 22; FHA domain, phosphorylation, intra | 3e-07 | |
| 2jqj_A | 151 | DNA damage response protein kinase DUN1; protein/p | 5e-07 | |
| 2kb3_A | 143 | Oxoglutarate dehydrogenase inhibitor; forkhead-ass | 9e-07 | |
| 2xt9_B | 115 | Putative signal transduction protein GARA; lyase-s | 1e-06 | |
| 1mzk_A | 139 | Kinase associated protein phosphatase; beta sandwi | 1e-06 | |
| 3hx1_A | 131 | SLR1951 protein; P74513_SYNY3, adenylate cyclase-l | 2e-06 | |
| 3po8_A | 100 | RV0020C protein, putative uncharacterized protein | 1e-05 | |
| 1g3g_A | 164 | Protien kinase SPK1; FHA domain, RAD53, phosphopep | 2e-05 | |
| 1g6g_A | 127 | Protein kinase RAD53; beta-sandwich, phosphopeptid | 3e-05 | |
| 1lgp_A | 116 | Cell cycle checkpoint protein CHFR; FHA, tungstate | 3e-04 | |
| 2pie_A | 138 | E3 ubiquitin-protein ligase RNF8; FHA domain, comp | 3e-04 |
| >2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} Length = 140 | Back alignment and structure |
|---|
Score = 93.8 bits (233), Expect = 6e-25
Identities = 53/71 (74%), Positives = 60/71 (84%)
Query: 118 AGKPPVGLHLDVLKEDKLVQKLMLDEKKCYLFGRNKDLCDICIDHQSCSRVHAAFVYHTA 177
AGKPP GLHLDV+K DKL++KL++DEKK YLFGRN DLCD IDHQSCSRVHAA VYH
Sbjct: 28 AGKPPPGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRVHAALVYHKH 87
Query: 178 LERAFLVDLGS 188
L+R FL+DL S
Sbjct: 88 LKRVFLIDLNS 98
|
| >3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A Length = 205 | Back alignment and structure |
|---|
| >3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} Length = 106 | Back alignment and structure |
|---|
| >3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} Length = 158 | Back alignment and structure |
|---|
| >3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B Length = 132 | Back alignment and structure |
|---|
| >1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 Length = 118 | Back alignment and structure |
|---|
| >1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* Length = 128 | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 | Back alignment and structure |
|---|
| >2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A Length = 162 | Back alignment and structure |
|---|
| >2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Length = 151 | Back alignment and structure |
|---|
| >2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A Length = 143 | Back alignment and structure |
|---|
| >2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} Length = 115 | Back alignment and structure |
|---|
| >3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} Length = 131 | Back alignment and structure |
|---|
| >3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} PDB: 3poa_A* 2lc1_A Length = 100 | Back alignment and structure |
|---|
| >1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* Length = 164 | Back alignment and structure |
|---|
| >1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 Length = 127 | Back alignment and structure |
|---|
| >1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A Length = 116 | Back alignment and structure |
|---|
| >2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 Length = 138 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| 3elv_A | 205 | PRE-mRNA leakage protein 1; intrinsically unstruct | 99.95 | |
| 4h87_A | 130 | Kanadaptin; FHA domain of PF00498, mRNA processing | 99.94 | |
| 3els_A | 158 | PRE-mRNA leakage protein 1; intrinsically unstruct | 99.9 | |
| 2jpe_A | 140 | Nuclear inhibitor of protein phosphatase 1; FHA do | 99.88 | |
| 3gqs_A | 106 | Adenylate cyclase-like protein; FHA domain, struct | 99.83 | |
| 1uht_A | 118 | Expressed protein; FHA domain, beta-sandwich, anti | 99.79 | |
| 3va4_A | 132 | Mediator of DNA damage checkpoint protein 1; cell | 99.77 | |
| 2xt9_B | 115 | Putative signal transduction protein GARA; lyase-s | 99.77 | |
| 2kb3_A | 143 | Oxoglutarate dehydrogenase inhibitor; forkhead-ass | 99.77 | |
| 1r21_A | 128 | Antigen KI-67; beta sandwich, cell cycle; NMR {Hom | 99.76 | |
| 2kfu_A | 162 | RV1827 PThr 22; FHA domain, phosphorylation, intra | 99.75 | |
| 1mzk_A | 139 | Kinase associated protein phosphatase; beta sandwi | 99.74 | |
| 3hx1_A | 131 | SLR1951 protein; P74513_SYNY3, adenylate cyclase-l | 99.72 | |
| 3po8_A | 100 | RV0020C protein, putative uncharacterized protein | 99.72 | |
| 2csw_A | 145 | Ubiquitin ligase protein RNF8; 11-stranded beta sa | 99.71 | |
| 2pie_A | 138 | E3 ubiquitin-protein ligase RNF8; FHA domain, comp | 99.69 | |
| 2jqj_A | 151 | DNA damage response protein kinase DUN1; protein/p | 99.69 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 99.68 | |
| 1g3g_A | 164 | Protien kinase SPK1; FHA domain, RAD53, phosphopep | 99.68 | |
| 1lgp_A | 116 | Cell cycle checkpoint protein CHFR; FHA, tungstate | 99.66 | |
| 1dmz_A | 158 | Protein (protein kinase SPK1); beta-sandwich, anti | 99.63 | |
| 1wln_A | 120 | Afadin; beta sandwich, FHA domain, structural geno | 99.61 | |
| 1gxc_A | 149 | CHK2, CDS1, serine/threonine-protein kinase CHK2; | 99.58 | |
| 1g6g_A | 127 | Protein kinase RAD53; beta-sandwich, phosphopeptid | 99.57 | |
| 1qu5_A | 182 | Protein kinase SPK1; FHA, RAD53, transferase; NMR | 99.57 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 99.54 | |
| 3huf_A | 325 | DNA repair and telomere maintenance protein NBS1; | 99.52 | |
| 4ejq_A | 154 | Kinesin-like protein KIF1A; homodimer, FHA domain, | 99.46 | |
| 4a0e_A | 123 | YSCD, type III secretion protein; transport protei | 99.39 | |
| 3fm8_A | 124 | Kinesin-like protein KIF13B; kinesin, GAP, GTPase | 99.36 | |
| 3uv0_A | 102 | Mutator 2, isoform B; FHA, protein binding, dimeri | 99.32 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 99.15 | |
| 3kt9_A | 102 | Aprataxin; FHA domain, beta sandwich, beta sheet, | 98.84 | |
| 2brf_A | 110 | Bifunctional polynucleotide phosphatase/kinase; hy | 98.52 | |
| 1ujx_A | 119 | Polynucleotide kinase 3'-phosphatase; DNA repair, | 98.42 | |
| 1yj5_C | 143 | 5' polynucleotide kinase-3' phosphatase FHA domai; | 98.39 | |
| 1wv3_A | 238 | Similar to DNA segregation ATPase and related prot | 98.27 | |
| 4egx_A | 184 | Kinesin-like protein KIF1A; FHA domain, transport | 98.21 | |
| 1wv3_A | 238 | Similar to DNA segregation ATPase and related prot | 82.97 |
| >3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A | Back alignment and structure |
|---|
Probab=99.95 E-value=2.8e-28 Score=200.92 Aligned_cols=111 Identities=21% Similarity=0.326 Sum_probs=76.4
Q ss_pred hhhcCCCCCCCCCCcccccCCCccccccccCCCcCccCCCCCCC-------------ceEEEEEeCCc----eeeEEEec
Q psy12929 80 NWLNTRPGGKDDISSMSMRGGAKVGANFSIDNSLTFAGAGKPPV-------------GLHLDVLKEDK----LVQKLMLD 142 (198)
Q Consensus 80 ~~~~~~p~g~~~i~s~~~~~~~~~~~~y~eP~~~~~~~a~~p~~-------------~~~L~v~~~~~----~~~~~~l~ 142 (198)
+.++|+|||+++.+++...+ +.++|.||+| |++|.. .|+|+|+|+|. .++++.|.
T Consensus 29 ~~pnf~~sg~L~~~~n~~~g---v~lky~eP~~-----a~~P~~~w~~~~~~~~~~~~~~L~v~k~g~k~~~~i~~~~L~ 100 (205)
T 3elv_A 29 IMPDFSPSGLLELESNNKEG---IALKHVEPQD-----AISPDNYMDMLGLEARDRTMYELVIYRKNDKDKGPWKRYDLN 100 (205)
T ss_dssp --------------------------CCCCCTT-----BCCHHHHHHHTTCCGGGSCCEEEEEEEGGGCTTCCSEEEECS
T ss_pred ccCCCcccccchhhhccccc---EEEeccCCCc-----ccCCchHHhhcccccccCCceEEEEEeCCCcccccceEEEec
Confidence 56899999999999999876 4999999999 888854 36799999876 57899998
Q ss_pred CcceEEeccCC--------------CCcceEeCCCCcCccceEEEEEccCC--eEEEEeCCCCCCeeecCcC
Q psy12929 143 EKKCYLFGRNK--------------DLCDICIDHQSCSRVHAAFVYHTALE--RAFLVDLGSILPRELYGVT 198 (198)
Q Consensus 143 ~~~~~~iGR~~--------------~~~di~l~~~~vSr~Ha~i~~~~~~~--~~~i~DL~StNGT~vNg~~ 198 (198)
.+++|+|||++ ..|||+|+||+|||+||+|+++..++ .++|+||+|+|||||||++
T Consensus 101 ~~s~y~IGR~~~~~~~~~~~~~~e~~~cDIvL~dp~VSR~HA~I~~~~~~~~~~~~l~DLgStNGTfVNG~r 172 (205)
T 3elv_A 101 GRSCYLVGRELGHSLDTDLDDRTEIVVADIGIPEETSSKQHCVIQFRNVRGILKCYVMDLDSSNGTCLNNVV 172 (205)
T ss_dssp SCSEEEEEECCCC---------CCCCCCSEEECCTTSCTTCEEEEEEEETTEEEEEEEECSCSSCCEETTEE
T ss_pred CCCceeecccccccccccccccccCccceEEeCCCCCCcccEEEEEecCCCceeEEEEeCCCCCCCeECCEE
Confidence 88899999995 35999999999999999999985322 4999999999999999974
|
| >4h87_A Kanadaptin; FHA domain of PF00498, mRNA processing, nucleus, structural joint center for structural genomics, JCSG, protein structu initiative; HET: SO4; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} | Back alignment and structure |
|---|
| >1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B | Back alignment and structure |
|---|
| >2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A | Back alignment and structure |
|---|
| >1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* | Back alignment and structure |
|---|
| >2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A | Back alignment and structure |
|---|
| >3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} | Back alignment and structure |
|---|
| >3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} SCOP: b.26.1.0 PDB: 3poa_A* 2lc1_A | Back alignment and structure |
|---|
| >2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* | Back alignment and structure |
|---|
| >1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A | Back alignment and structure |
|---|
| >1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* | Back alignment and structure |
|---|
| >1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* | Back alignment and structure |
|---|
| >4ejq_A Kinesin-like protein KIF1A; homodimer, FHA domain, transport protein; 1.89A {Homo sapiens} PDB: 2eh0_A 2g1l_A | Back alignment and structure |
|---|
| >4a0e_A YSCD, type III secretion protein; transport protein, SAD phasing, type III secretion system; 2.04A {Yersinia pestis} PDB: 4d9v_A | Back alignment and structure |
|---|
| >3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* | Back alignment and structure |
|---|
| >3uv0_A Mutator 2, isoform B; FHA, protein binding, dimerization; 1.90A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >3kt9_A Aprataxin; FHA domain, beta sandwich, beta sheet, AMP hydrolase, alternative splicing, disease mutation, DNA damage, DNA repair, DNA-binding; 1.65A {Homo sapiens} SCOP: b.26.1.0 | Back alignment and structure |
|---|
| >2brf_A Bifunctional polynucleotide phosphatase/kinase; hydrolase/transferase, FHA, forkhead-associated, PNKP, PNK, polynucleotide kinase 3' phosphatase; 1.40A {Homo sapiens} SCOP: b.26.1.2 PDB: 2w3o_A* 1yjm_A* | Back alignment and structure |
|---|
| >1ujx_A Polynucleotide kinase 3'-phosphatase; DNA repair, FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif; NMR {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1yj5_C 5' polynucleotide kinase-3' phosphatase FHA domai; beta sandwich, P-loop, transferase; 2.80A {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1wv3_A Similar to DNA segregation ATPase and related proteins; structural genomics, unknown function; 1.75A {Staphylococcus aureus subsp} SCOP: b.26.1.4 b.26.1.4 | Back alignment and structure |
|---|
| >4egx_A Kinesin-like protein KIF1A; FHA domain, transport protein; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >1wv3_A Similar to DNA segregation ATPase and related proteins; structural genomics, unknown function; 1.75A {Staphylococcus aureus subsp} SCOP: b.26.1.4 b.26.1.4 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 198 | ||||
| d1uhta_ | 118 | b.26.1.2 (A:) FHA domain containing protein At4G14 | 5e-12 | |
| d1g6ga_ | 127 | b.26.1.2 (A:) Phosphotyrosine binding domain of Ra | 5e-09 | |
| d1dmza_ | 158 | b.26.1.2 (A:) Phosphotyrosine binding domain of Ra | 2e-07 | |
| d1mzka_ | 122 | b.26.1.2 (A:) Kinase associated protein phosphatas | 0.003 |
| >d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 118 | Back information, alignment and structure |
|---|
class: All beta proteins fold: SMAD/FHA domain superfamily: SMAD/FHA domain family: FHA domain domain: FHA domain containing protein At4G14490 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 58.1 bits (140), Expect = 5e-12
Identities = 16/82 (19%), Positives = 22/82 (26%), Gaps = 2/82 (2%)
Query: 116 AGAGKPPVGLHLDVLKEDKLVQKLMLDEKKCYLFGRNKDLCDICIDHQSCSRVHAAFVYH 175
+G L L +K + L GR +I I S H
Sbjct: 4 GSSGMVTPSLRLVFVKGPREGDALDYKPGSTIRVGRIVRGNEIAIKDAGISTKHLRIESD 63
Query: 176 TALERAFLVDLGSILPRELYGV 197
+ + DLGS L
Sbjct: 64 S--GNWVIQDLGSSNGTLLNSN 83
|
| >d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 127 | Back information, alignment and structure |
|---|
| >d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 158 | Back information, alignment and structure |
|---|
| >d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 122 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| d1uhta_ | 118 | FHA domain containing protein At4G14490 {Thale cre | 99.8 | |
| d1mzka_ | 122 | Kinase associated protein phosphatase {Thale cress | 99.76 | |
| d2ff4a3 | 99 | Probable regulatory protein EmbR, C-terminal domai | 99.72 | |
| d2affa1 | 98 | Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} | 99.65 | |
| d2piea1 | 127 | Ubiquitin ligase protein RNF8 {Human (Homo sapiens | 99.64 | |
| d1lgpa_ | 113 | Cell cycle checkpoint protein Chfr {Human (Homo sa | 99.62 | |
| d1dmza_ | 158 | Phosphotyrosine binding domain of Rad53 {Baker's y | 99.59 | |
| d1g6ga_ | 127 | Phosphotyrosine binding domain of Rad53 {Baker's y | 99.55 | |
| d1gxca_ | 116 | Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.54 | |
| d2brfa1 | 101 | Polynucleotide kinase 3'-phosphatase {Human (Homo | 99.44 | |
| d1wlna1 | 107 | Afadin {Mouse (Mus musculus) [TaxId: 10090]} | 99.38 | |
| d2g1la1 | 102 | Kinesin-like protein kif1c {Human (Homo sapiens) [ | 99.36 |
| >d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: SMAD/FHA domain superfamily: SMAD/FHA domain family: FHA domain domain: FHA domain containing protein At4G14490 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.80 E-value=3.3e-20 Score=138.82 Aligned_cols=76 Identities=20% Similarity=0.083 Sum_probs=65.8
Q ss_pred CCCceEEEEEeCCceeeEEEecCcceEEeccCCCCcceEeCCCCcCccceEEEEEccCCeEEEEeCCCCCCeeecCcC
Q psy12929 121 PPVGLHLDVLKEDKLVQKLMLDEKKCYLFGRNKDLCDICIDHQSCSRVHAAFVYHTALERAFLVDLGSILPRELYGVT 198 (198)
Q Consensus 121 p~~~~~L~v~~~~~~~~~~~l~~~~~~~iGR~~~~~di~l~~~~vSr~Ha~i~~~~~~~~~~i~DL~StNGT~vNg~~ 198 (198)
..+.++|.+.++...++.+.|..++.++|||+...|||+|+|++|||+||+|.++ +++|+|+||+|+|||||||++
T Consensus 9 ~~p~l~L~v~~Gp~~g~~~~l~~~~~~~iGR~~~~~di~l~d~~VSr~Ha~i~~~--~~~~~i~Dl~S~nGT~vng~~ 84 (118)
T d1uhta_ 9 VTPSLRLVFVKGPREGDALDYKPGSTIRVGRIVRGNEIAIKDAGISTKHLRIESD--SGNWVIQDLGSSNGTLLNSNA 84 (118)
T ss_dssp CSCEEEEEESSSTTTTCBCCBCTTCCEEEESSSTTCSEECCSSSSCTTCEEEEEC--SSSEEEECCCCSSCCEESSSB
T ss_pred CCCcEEEEEEeCCCCCcEEEeCCCCEEEECCCCcCCeEEeCccCcchheeEEEEE--CCEEEEEECCCcceeEECCEE
Confidence 3345789888877777889997777799999855899999999999999999987 478999999999999999974
|
| >d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|