Diaphorina citri psyllid: psy12932


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MAAITTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQ
ccccccccEEEEEEcccHHHHHHHHHHHHHcccEEEEEEEEccEEEEEEEHHHccccHHHHHHHHHccccccHHHHHHHHHHHHHccEEEEEHHHHHHHHccccccc
******GTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAITTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005700 [CC]polytene chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GA1, chain A
Confidence level:very confident
Coverage over the Query: 8-63
View the alignment between query and template
View the model in PyMOL
Template: 2VPK, chain A
Confidence level:very confident
Coverage over the Query: 64-107
View the alignment between query and template
View the model in PyMOL