Psyllid ID: psy12932
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 107 | ||||||
| 195582232 | 671 | GD25965 [Drosophila simulans] gi|1941929 | 0.906 | 0.144 | 0.412 | 1e-15 | |
| 242016203 | 272 | bric-A-brac, putative [Pediculus humanus | 0.785 | 0.308 | 0.417 | 6e-10 | |
| 157167331 | 429 | bric-a-brac [Aedes aegypti] gi|108882904 | 0.560 | 0.139 | 0.45 | 1e-09 | |
| 241701538 | 448 | zinc finger protein, putative [Ixodes sc | 0.485 | 0.116 | 0.538 | 2e-09 | |
| 442759685 | 441 | Putative bric a brac 2 [Ixodes ricinus] | 0.719 | 0.174 | 0.435 | 2e-09 | |
| 345494983 | 492 | PREDICTED: hypothetical protein LOC10012 | 0.504 | 0.109 | 0.555 | 2e-09 | |
| 158295170 | 1095 | AGAP006018-PA [Anopheles gambiae str. PE | 0.504 | 0.049 | 0.481 | 2e-09 | |
| 195336475 | 575 | GM14235 [Drosophila sechellia] gi|194127 | 0.457 | 0.085 | 0.490 | 2e-09 | |
| 442629331 | 1066 | bric a brac 2, isoform B [Drosophila mel | 0.457 | 0.045 | 0.490 | 2e-09 | |
| 6634127 | 1067 | BAB-II protein [Drosophila melanogaster] | 0.457 | 0.045 | 0.490 | 2e-09 |
| >gi|195582232|ref|XP_002080932.1| GD25965 [Drosophila simulans] gi|194192941|gb|EDX06517.1| GD25965 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
Score = 87.0 bits (214), Expect = 1e-15, Method: Composition-based stats.
Identities = 45/109 (41%), Positives = 65/109 (59%), Gaps = 12/109 (11%)
Query: 10 FCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFF--------- 60
FC++W N Q L LL+ E++VD TL AEG+ +AH+++LSA SP+F
Sbjct: 7 FCLRWNNHQSTLISVFDTLLENETLVDCTLAAEGKFLKAHKVVLSACSPYFAMDDDQQFC 66
Query: 61 ---QNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFF 106
N Q L LL+ E++VD TL AEG+ +AH+++LSA SP+F
Sbjct: 67 LRWNNHQSTLISVFDTLLENETLVDCTLAAEGKFLKAHKVVLSACSPYF 115
|
Source: Drosophila simulans Species: Drosophila simulans Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242016203|ref|XP_002428719.1| bric-A-brac, putative [Pediculus humanus corporis] gi|212513396|gb|EEB15981.1| bric-A-brac, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|157167331|ref|XP_001660259.1| bric-a-brac [Aedes aegypti] gi|108882904|gb|EAT47129.1| AAEL001739-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|241701538|ref|XP_002402860.1| zinc finger protein, putative [Ixodes scapularis] gi|215504895|gb|EEC14389.1| zinc finger protein, putative [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
| >gi|442759685|gb|JAA72001.1| Putative bric a brac 2 [Ixodes ricinus] | Back alignment and taxonomy information |
|---|
| >gi|345494983|ref|XP_001605103.2| PREDICTED: hypothetical protein LOC100121492 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|158295170|ref|XP_316056.4| AGAP006018-PA [Anopheles gambiae str. PEST] gi|157015906|gb|EAA11698.4| AGAP006018-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|195336475|ref|XP_002034861.1| GM14235 [Drosophila sechellia] gi|194127954|gb|EDW49997.1| GM14235 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|442629331|ref|NP_001261242.1| bric a brac 2, isoform B [Drosophila melanogaster] gi|440215109|gb|AGB93937.1| bric a brac 2, isoform B [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|6634127|emb|CAB64388.1| BAB-II protein [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 107 | ||||||
| FB|FBgn0004870 | 977 | bab1 "bric a brac 1" [Drosophi | 0.532 | 0.058 | 0.438 | 8.3e-10 | |
| FB|FBgn0025525 | 1067 | bab2 "bric a brac 2" [Drosophi | 0.514 | 0.051 | 0.490 | 1.2e-09 | |
| FB|FBgn0004652 | 955 | fru "fruitless" [Drosophila me | 0.738 | 0.082 | 0.395 | 3.2e-08 | |
| FB|FBgn0003254 | 661 | rib "ribbon" [Drosophila melan | 0.523 | 0.084 | 0.428 | 3.2e-08 | |
| FB|FBgn0003870 | 813 | ttk "tramtrack" [Drosophila me | 0.738 | 0.097 | 0.372 | 8.8e-08 | |
| FB|FBgn0000210 | 880 | br "broad" [Drosophila melanog | 0.495 | 0.060 | 0.433 | 1.2e-07 | |
| FB|FBgn0264981 | 1089 | mamo "maternal gene required f | 0.747 | 0.073 | 0.363 | 1.6e-07 | |
| FB|FBgn0005630 | 970 | lola "longitudinals lacking" [ | 0.738 | 0.081 | 0.360 | 1.8e-07 | |
| FB|FBgn0022238 | 127 | lolal "lola like" [Drosophila | 0.542 | 0.456 | 0.362 | 2.3e-07 | |
| FB|FBgn0052121 | 648 | CG32121 [Drosophila melanogast | 0.495 | 0.081 | 0.452 | 3.7e-07 |
| FB|FBgn0004870 bab1 "bric a brac 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 144 (55.7 bits), Expect = 8.3e-10, Sum P(2) = 8.3e-10
Identities = 25/57 (43%), Positives = 39/57 (68%)
Query: 5 TTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQ 61
++ FC++W N+Q +L QLL+ E VDVTL +G + +AH+++LSA SP+FQ
Sbjct: 97 SSSQQFCLRWNNYQTNLTTIFDQLLQNECFVDVTLACDGRSMKAHKMVLSACSPYFQ 153
|
|
| FB|FBgn0025525 bab2 "bric a brac 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0004652 fru "fruitless" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0003254 rib "ribbon" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0003870 ttk "tramtrack" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0000210 br "broad" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0264981 mamo "maternal gene required for meiosis" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0005630 lola "longitudinals lacking" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0022238 lolal "lola like" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0052121 CG32121 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 107 | |||
| pfam00651 | 101 | pfam00651, BTB, BTB/POZ domain | 8e-08 | |
| pfam00651 | 101 | pfam00651, BTB, BTB/POZ domain | 1e-07 | |
| smart00225 | 97 | smart00225, BTB, Broad-Complex, Tramtrack and Bric | 4e-05 | |
| smart00225 | 97 | smart00225, BTB, Broad-Complex, Tramtrack and Bric | 5e-05 |
| >gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain | Back alignment and domain information |
|---|
Score = 46.1 bits (110), Expect = 8e-08
Identities = 14/38 (36%), Positives = 23/38 (60%)
Query: 25 LYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQN 62
L +L + + DVTL + F AH+ +L+A SP+F+
Sbjct: 1 LNELRENGELCDVTLVVGDKEFHAHKAVLAACSPYFKA 38
|
The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN. Length = 101 |
| >gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain | Back alignment and domain information |
|---|
| >gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac | Back alignment and domain information |
|---|
| >gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| KOG4441|consensus | 571 | 99.21 | ||
| PHA02713 | 557 | hypothetical protein; Provisional | 99.15 | |
| PHA02713 | 557 | hypothetical protein; Provisional | 98.9 | |
| KOG4441|consensus | 571 | 98.79 | ||
| KOG0783|consensus | 1267 | 98.53 | ||
| PHA02790 | 480 | Kelch-like protein; Provisional | 98.52 | |
| PF00651 | 111 | BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( | 98.49 | |
| PF00651 | 111 | BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( | 98.47 | |
| PHA02790 | 480 | Kelch-like protein; Provisional | 98.46 | |
| KOG4350|consensus | 620 | 98.39 | ||
| KOG2838|consensus | 401 | 98.35 | ||
| KOG4350|consensus | 620 | 98.32 | ||
| PHA03098 | 534 | kelch-like protein; Provisional | 98.16 | |
| PHA03098 | 534 | kelch-like protein; Provisional | 98.13 | |
| KOG4591|consensus | 280 | 97.61 | ||
| KOG2838|consensus | 401 | 97.35 | ||
| smart00225 | 90 | BTB Broad-Complex, Tramtrack and Bric a brac. Doma | 97.22 | |
| KOG4591|consensus | 280 | 97.17 | ||
| KOG0783|consensus | 1267 | 96.66 | ||
| KOG2075|consensus | 521 | 95.92 | ||
| KOG0511|consensus | 516 | 95.75 | ||
| KOG0511|consensus | 516 | 94.88 | ||
| KOG2075|consensus | 521 | 93.24 |
| >KOG4441|consensus | Back alignment and domain information |
|---|
Probab=99.21 E-value=1.2e-11 Score=92.33 Aligned_cols=61 Identities=26% Similarity=0.338 Sum_probs=56.4
Q ss_pred cccCCceEEEEeCchHHHHHHHHHHHHhCCCeeeEEEEeCCeEEeecceeeeccCcccccc
Q psy12932 3 AITTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNF 63 (107)
Q Consensus 3 ~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~Dv~~~~~~~~~~~h~~vl~~~s~~f~~~ 63 (107)
+........+..+.|...+++.|+.+|+++.+|||++.+++++|+|||.||+++||||++|
T Consensus 5 ~~~~~~~~~~~~~~h~~~~l~~l~~lr~~~~lcDv~L~v~~~~~~aHR~VLAa~S~YFraM 65 (571)
T KOG4441|consen 5 DEIFNSTSEFTDPSHSKFLLQGLNELREEGLLCDVTLLVGDREFPAHRVVLAACSPYFRAM 65 (571)
T ss_pred ccccccccccccHHHHHHHHHHHHHHHHhCCCceEEEEECCeeechHHHHHHhccHHHHHH
Confidence 3445566788999999999999999999999999999999999999999999999999998
|
|
| >PHA02713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4441|consensus | Back alignment and domain information |
|---|
| >KOG0783|consensus | Back alignment and domain information |
|---|
| >PHA02790 Kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins | Back alignment and domain information |
|---|
| >PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins | Back alignment and domain information |
|---|
| >PHA02790 Kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4350|consensus | Back alignment and domain information |
|---|
| >KOG2838|consensus | Back alignment and domain information |
|---|
| >KOG4350|consensus | Back alignment and domain information |
|---|
| >PHA03098 kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03098 kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4591|consensus | Back alignment and domain information |
|---|
| >KOG2838|consensus | Back alignment and domain information |
|---|
| >smart00225 BTB Broad-Complex, Tramtrack and Bric a brac | Back alignment and domain information |
|---|
| >KOG4591|consensus | Back alignment and domain information |
|---|
| >KOG0783|consensus | Back alignment and domain information |
|---|
| >KOG2075|consensus | Back alignment and domain information |
|---|
| >KOG0511|consensus | Back alignment and domain information |
|---|
| >KOG0511|consensus | Back alignment and domain information |
|---|
| >KOG2075|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 107 | |||
| 1r29_A | 127 | B-cell lymphoma 6 protein; BTB domain, transcripti | 1e-09 | |
| 1r29_A | 127 | B-cell lymphoma 6 protein; BTB domain, transcripti | 7e-09 | |
| 2if5_A | 120 | Zinc finger and BTB domain-containing protein 7A; | 1e-09 | |
| 2if5_A | 120 | Zinc finger and BTB domain-containing protein 7A; | 1e-08 | |
| 4eoz_A | 145 | Speckle-type POZ protein; E3 ubiquitin ligase, nuc | 1e-09 | |
| 4eoz_A | 145 | Speckle-type POZ protein; E3 ubiquitin ligase, nuc | 1e-09 | |
| 3hve_A | 256 | Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis | 2e-09 | |
| 3hve_A | 256 | Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis | 5e-09 | |
| 3htm_A | 172 | Speckle-type POZ protein; BTB, SPOP, ubiquitin, li | 5e-09 | |
| 3htm_A | 172 | Speckle-type POZ protein; BTB, SPOP, ubiquitin, li | 5e-09 | |
| 3ohu_A | 125 | Transcription regulator protein BACH2; BTB/POZ dom | 6e-09 | |
| 3ohu_A | 125 | Transcription regulator protein BACH2; BTB/POZ dom | 5e-08 | |
| 3ga1_A | 129 | Nucleus accumbens-associated protein 1; BTB/POZ do | 1e-08 | |
| 3ga1_A | 129 | Nucleus accumbens-associated protein 1; BTB/POZ do | 9e-08 | |
| 2ppi_A | 144 | Gigaxonin; BTB domain, protein degradation, struct | 1e-08 | |
| 2ppi_A | 144 | Gigaxonin; BTB domain, protein degradation, struct | 1e-08 | |
| 3b84_A | 119 | Zinc finger and BTB domain-containing protein 48; | 2e-08 | |
| 3b84_A | 119 | Zinc finger and BTB domain-containing protein 48; | 5e-08 | |
| 2vpk_A | 116 | Myoneurin; transcription regulation, transcription | 3e-08 | |
| 2vpk_A | 116 | Myoneurin; transcription regulation, transcription | 3e-08 | |
| 2z8h_A | 138 | Transcription regulator protein BACH1; BTB, POZ, d | 3e-08 | |
| 2z8h_A | 138 | Transcription regulator protein BACH1; BTB, POZ, d | 8e-08 | |
| 2ihc_A | 124 | Transcription regulator protein BACH1; BRIC-A-BRAC | 3e-08 | |
| 2ihc_A | 124 | Transcription regulator protein BACH1; BRIC-A-BRAC | 1e-07 | |
| 2yy9_A | 135 | Zinc finger and BTB domain-containing protein 48; | 4e-08 | |
| 2yy9_A | 135 | Zinc finger and BTB domain-containing protein 48; | 4e-08 | |
| 2q81_A | 119 | MIZ-1 protein; BTB/POZ domain, transcription; HET: | 4e-08 | |
| 2q81_A | 119 | MIZ-1 protein; BTB/POZ domain, transcription; HET: | 6e-08 | |
| 3m5b_A | 119 | Zinc finger and BTB domain-containing protein 32; | 1e-07 | |
| 3m5b_A | 119 | Zinc finger and BTB domain-containing protein 32; | 1e-07 | |
| 3fkc_A | 116 | Transcriptional regulator kaiso; zinc finger and B | 1e-07 | |
| 3fkc_A | 116 | Transcriptional regulator kaiso; zinc finger and B | 1e-07 | |
| 1buo_A | 121 | POZ domain, protein (promyelocytic leukemia zinc f | 2e-07 | |
| 1buo_A | 121 | POZ domain, protein (promyelocytic leukemia zinc f | 2e-07 | |
| 3hqi_A | 312 | Speckle-type POZ protein; SPOP, ubiquitin, puckere | 6e-07 | |
| 3hqi_A | 312 | Speckle-type POZ protein; SPOP, ubiquitin, puckere | 7e-07 | |
| 3i3n_A | 279 | Kelch-like protein 11; structural genomics, BTB, K | 7e-07 | |
| 3i3n_A | 279 | Kelch-like protein 11; structural genomics, BTB, K | 7e-07 | |
| 2vkp_A | 109 | BTB/POZ domain-containing protein 6; protein-bindi | 3e-06 | |
| 2vkp_A | 109 | BTB/POZ domain-containing protein 6; protein-bindi | 3e-06 |
| >1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 | Back alignment and structure |
|---|
Score = 50.7 bits (122), Expect = 1e-09
Identities = 12/52 (23%), Positives = 24/52 (46%)
Query: 9 NFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFF 60
+ +++ + L +L + + DV + E F+AH+ +L A S F
Sbjct: 4 DSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLF 55
|
| >1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 | Back alignment and structure |
|---|
| >2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 | Back alignment and structure |
|---|
| >2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 | Back alignment and structure |
|---|
| >4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 | Back alignment and structure |
|---|
| >3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 | Back alignment and structure |
|---|
| >3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 | Back alignment and structure |
|---|
| >3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 | Back alignment and structure |
|---|
| >3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 | Back alignment and structure |
|---|
| >3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 | Back alignment and structure |
|---|
| >3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
| >3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
| >2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 | Back alignment and structure |
|---|
| >2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 | Back alignment and structure |
|---|
| >2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 | Back alignment and structure |
|---|
| >2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 | Back alignment and structure |
|---|
| >3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 | Back alignment and structure |
|---|
| >3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 | Back alignment and structure |
|---|
| >1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 | Back alignment and structure |
|---|
| >1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 | Back alignment and structure |
|---|
| >3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 | Back alignment and structure |
|---|
| >3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 | Back alignment and structure |
|---|
| >2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| 3ga1_A | 129 | Nucleus accumbens-associated protein 1; BTB/POZ do | 99.51 | |
| 3fkc_A | 116 | Transcriptional regulator kaiso; zinc finger and B | 99.5 | |
| 2ihc_A | 124 | Transcription regulator protein BACH1; BRIC-A-BRAC | 99.49 | |
| 2z8h_A | 138 | Transcription regulator protein BACH1; BTB, POZ, d | 99.47 | |
| 3ohu_A | 125 | Transcription regulator protein BACH2; BTB/POZ dom | 99.45 | |
| 3b84_A | 119 | Zinc finger and BTB domain-containing protein 48; | 99.44 | |
| 1buo_A | 121 | POZ domain, protein (promyelocytic leukemia zinc f | 99.44 | |
| 2if5_A | 120 | Zinc finger and BTB domain-containing protein 7A; | 99.41 | |
| 2q81_A | 119 | MIZ-1 protein; BTB/POZ domain, transcription; HET: | 99.39 | |
| 1r29_A | 127 | B-cell lymphoma 6 protein; BTB domain, transcripti | 99.39 | |
| 2yy9_A | 135 | Zinc finger and BTB domain-containing protein 48; | 99.37 | |
| 2ppi_A | 144 | Gigaxonin; BTB domain, protein degradation, struct | 99.36 | |
| 2vpk_A | 116 | Myoneurin; transcription regulation, transcription | 99.33 | |
| 3i3n_A | 279 | Kelch-like protein 11; structural genomics, BTB, K | 99.3 | |
| 3hve_A | 256 | Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis | 99.29 | |
| 3m5b_A | 119 | Zinc finger and BTB domain-containing protein 32; | 99.21 | |
| 3b84_A | 119 | Zinc finger and BTB domain-containing protein 48; | 99.15 | |
| 2ihc_A | 124 | Transcription regulator protein BACH1; BRIC-A-BRAC | 99.14 | |
| 2z8h_A | 138 | Transcription regulator protein BACH1; BTB, POZ, d | 99.13 | |
| 2vpk_A | 116 | Myoneurin; transcription regulation, transcription | 99.13 | |
| 2q81_A | 119 | MIZ-1 protein; BTB/POZ domain, transcription; HET: | 99.12 | |
| 1buo_A | 121 | POZ domain, protein (promyelocytic leukemia zinc f | 99.12 | |
| 3ohu_A | 125 | Transcription regulator protein BACH2; BTB/POZ dom | 99.11 | |
| 2yy9_A | 135 | Zinc finger and BTB domain-containing protein 48; | 99.11 | |
| 3fkc_A | 116 | Transcriptional regulator kaiso; zinc finger and B | 99.1 | |
| 1r29_A | 127 | B-cell lymphoma 6 protein; BTB domain, transcripti | 99.09 | |
| 2if5_A | 120 | Zinc finger and BTB domain-containing protein 7A; | 99.09 | |
| 3m5b_A | 119 | Zinc finger and BTB domain-containing protein 32; | 99.08 | |
| 3ga1_A | 129 | Nucleus accumbens-associated protein 1; BTB/POZ do | 99.05 | |
| 2ppi_A | 144 | Gigaxonin; BTB domain, protein degradation, struct | 99.05 | |
| 4eoz_A | 145 | Speckle-type POZ protein; E3 ubiquitin ligase, nuc | 99.03 | |
| 3htm_A | 172 | Speckle-type POZ protein; BTB, SPOP, ubiquitin, li | 99.03 | |
| 3i3n_A | 279 | Kelch-like protein 11; structural genomics, BTB, K | 98.99 | |
| 4eoz_A | 145 | Speckle-type POZ protein; E3 ubiquitin ligase, nuc | 98.96 | |
| 3htm_A | 172 | Speckle-type POZ protein; BTB, SPOP, ubiquitin, li | 98.89 | |
| 3hve_A | 256 | Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis | 98.86 | |
| 3hqi_A | 312 | Speckle-type POZ protein; SPOP, ubiquitin, puckere | 98.83 | |
| 3hqi_A | 312 | Speckle-type POZ protein; SPOP, ubiquitin, puckere | 98.77 | |
| 2vkp_A | 109 | BTB/POZ domain-containing protein 6; protein-bindi | 98.74 | |
| 2vkp_A | 109 | BTB/POZ domain-containing protein 6; protein-bindi | 97.22 | |
| 4ajy_C | 97 | Transcription elongation factor B polypeptide 1; E | 94.0 | |
| 2ast_A | 159 | S-phase kinase-associated protein 1A; SCF-substrat | 89.46 |
| >3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.51 E-value=1e-14 Score=88.75 Aligned_cols=62 Identities=27% Similarity=0.425 Sum_probs=54.7
Q ss_pred CcccCCceEEEEeCchHHHHHHHHHHHHhCCCeeeEEEEeCCeEEeecceeeeccCcccccc
Q psy12932 2 AAITTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNF 63 (107)
Q Consensus 2 ~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~Dv~~~~~~~~~~~h~~vl~~~s~~f~~~ 63 (107)
|+..+.+.+.++++++...+++.|++++.++.+|||++.++++.|+|||.||+++|+||+++
T Consensus 1 gp~~~~~~~~~~~~~~~~~l~~~l~~l~~~~~~~Dv~l~v~~~~~~~Hk~vLaa~S~~F~~~ 62 (129)
T 3ga1_A 1 GPLGSAQTLQMEIPNFGNSILECLNEQRLQGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDL 62 (129)
T ss_dssp ------CEEEEECTTHHHHHHHHHHHHHHTTCSCCEEEEETTEEEEECHHHHHHHBHHHHHH
T ss_pred CCCCCCceEEeecCcHHHHHHHHHHHHHhcCCCcceEEEECCEEEEehHHHHHHcCHHHHHH
Confidence 35567789999999999999999999999999999999999999999999999999999877
|
| >3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A | Back alignment and structure |
|---|
| >2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} | Back alignment and structure |
|---|
| >2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A | Back alignment and structure |
|---|
| >3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A | Back alignment and structure |
|---|
| >2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A | Back alignment and structure |
|---|
| >2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A | Back alignment and structure |
|---|
| >1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A | Back alignment and structure |
|---|
| >2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A | Back alignment and structure |
|---|
| >3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B | Back alignment and structure |
|---|
| >3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 | Back alignment and structure |
|---|
| >3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} | Back alignment and structure |
|---|
| >2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A | Back alignment and structure |
|---|
| >1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A | Back alignment and structure |
|---|
| >3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A | Back alignment and structure |
|---|
| >2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A | Back alignment and structure |
|---|
| >1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A | Back alignment and structure |
|---|
| >2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A | Back alignment and structure |
|---|
| >3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 | Back alignment and structure |
|---|
| >3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A | Back alignment and structure |
|---|
| >4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A | Back alignment and structure |
|---|
| >2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} | Back alignment and structure |
|---|
| >2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} | Back alignment and structure |
|---|
| >4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 107 | ||||
| d1r29a_ | 122 | d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB | 1e-07 | |
| d1r29a_ | 122 | d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB | 7e-06 | |
| d1buoa_ | 121 | d.42.1.1 (A:) Promyelocytic leukaemia zinc finger | 5e-07 | |
| d1buoa_ | 121 | d.42.1.1 (A:) Promyelocytic leukaemia zinc finger | 4e-06 |
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: POZ domain superfamily: POZ domain family: BTB/POZ domain domain: B-cell lymphoma 6 (Bcl6) protein BTB domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 44.3 bits (104), Expect = 1e-07
Identities = 12/71 (16%), Positives = 30/71 (42%)
Query: 12 MKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNFQVHLAFEL 71
+++ + L +L + + DV + E F+AH+ +L A S F +
Sbjct: 3 IQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRN 62
Query: 72 YQLLKMESMVD 82
++ ++ ++
Sbjct: 63 LSVINLDPEIN 73
|
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
| >d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 | Back information, alignment and structure |
|---|
| >d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| d1buoa_ | 121 | Promyelocytic leukaemia zinc finger (PLZF) protein | 99.54 | |
| d1r29a_ | 122 | B-cell lymphoma 6 (Bcl6) protein BTB domain {Human | 99.47 | |
| d1buoa_ | 121 | Promyelocytic leukaemia zinc finger (PLZF) protein | 99.16 | |
| d1r29a_ | 122 | B-cell lymphoma 6 (Bcl6) protein BTB domain {Human | 99.11 |
| >d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: POZ domain superfamily: POZ domain family: BTB/POZ domain domain: Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.54 E-value=1.3e-15 Score=90.79 Aligned_cols=55 Identities=20% Similarity=0.347 Sum_probs=52.6
Q ss_pred eEEEEeCchHHHHHHHHHHHHhCCCeeeEEEEeCCeEEeecceeeeccCcccccc
Q psy12932 9 NFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNF 63 (107)
Q Consensus 9 ~~~~~~~~~~~~~~~~l~~l~~~~~~~Dv~~~~~~~~~~~h~~vl~~~s~~f~~~ 63 (107)
.+.+++++|+..+++.|+++|.+|.+||+++.+++++|+|||+||+++|+||+++
T Consensus 3 ~~~~~~~~h~~~ll~~l~~l~~~~~~~Dv~l~v~~~~~~aHk~vLaa~S~~F~~l 57 (121)
T d1buoa_ 3 MIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFEIL 57 (121)
T ss_dssp CCCCCCTTHHHHHHHHHHHHHHHTTTCCEEEEESSCEEEECHHHHHHHCHHHHHH
T ss_pred eEEEcCCchHHHHHHHHHHHHhcCCcEeEEEEECCEEEEEEHHHhcccChhhhhh
Confidence 5668899999999999999999999999999999999999999999999999887
|
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|