Psyllid ID: psy12932


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MAAITTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQ
ccccccccEEEEEEcccHHHHHHHHHHHHHcccEEEEEEEEccEEEEEEEHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHccEEEEEHHHHHHHHHcccccc
ccccccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEEcccEEHHHHEEEccccHHHHHccccccEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
maaittgtnFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIilsasspffqNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIilsasspffq
maaittgtnfcmkWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRiilsasspffq
MAAITTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQ
***ITTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIIL********
***********MKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQ
MAAITTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQ
******GTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAITTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query107 2.2.26 [Sep-21-2011]
Q9W0K4 1067 Protein bric-a-brac 2 OS= yes N/A 0.457 0.045 0.490 6e-11
Q9W0K7 977 Protein bric-a-brac 1 OS= no N/A 0.504 0.055 0.462 5e-10
Q8IN81 955 Sex determination protein no N/A 0.738 0.082 0.395 3e-09
P17789 643 Protein tramtrack, beta i no N/A 0.738 0.122 0.372 6e-09
Q9V5M6 963 Longitudinals lacking pro no N/A 0.719 0.079 0.375 8e-09
Q7KQZ4 787 Longitudinals lacking pro no N/A 0.719 0.097 0.375 8e-09
P42282 813 Protein tramtrack, alpha no N/A 0.738 0.097 0.372 1e-08
Q01295 727 Broad-complex core protei no N/A 0.514 0.075 0.418 1e-08
P42283 891 Longitudinals lacking pro no N/A 0.719 0.086 0.375 1e-08
Q867Z4 970 Longitudinals lacking pro no N/A 0.719 0.079 0.375 1e-08
>sp|Q9W0K4|BAB2_DROME Protein bric-a-brac 2 OS=Drosophila melanogaster GN=bab2 PE=1 SV=2 Back     alignment and function desciption
 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (70%)

Query: 7   GTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQ 61
           G  FC++W N+Q +L     +LL+ ES VDVTL  EG + +AH+++LSA SP+FQ
Sbjct: 195 GQQFCLRWNNYQSNLTNVFDELLQSESFVDVTLSCEGHSIKAHKMVLSACSPYFQ 249




Probably acts as a transcriptional regulator. Required for the specification of the tarsal segment. Also involved in antenna development.
Drosophila melanogaster (taxid: 7227)
>sp|Q9W0K7|BAB1_DROME Protein bric-a-brac 1 OS=Drosophila melanogaster GN=bab1 PE=2 SV=2 Back     alignment and function description
>sp|Q8IN81|FRU_DROME Sex determination protein fruitless OS=Drosophila melanogaster GN=fru PE=1 SV=1 Back     alignment and function description
>sp|P17789|TTKB_DROME Protein tramtrack, beta isoform OS=Drosophila melanogaster GN=ttk PE=1 SV=2 Back     alignment and function description
>sp|Q9V5M6|LOLA5_DROME Longitudinals lacking protein, isoforms J/P/Q/S/Z OS=Drosophila melanogaster GN=lola PE=1 SV=4 Back     alignment and function description
>sp|Q7KQZ4|LOLA3_DROME Longitudinals lacking protein, isoforms A/B/D/L OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function description
>sp|P42282|TTKA_DROME Protein tramtrack, alpha isoform OS=Drosophila melanogaster GN=ttk PE=1 SV=3 Back     alignment and function description
>sp|Q01295|BRC1_DROME Broad-complex core protein isoforms 1/2/3/4/5 OS=Drosophila melanogaster GN=br PE=1 SV=2 Back     alignment and function description
>sp|P42283|LOLA1_DROME Longitudinals lacking protein, isoform G OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description
>sp|Q867Z4|LOLA4_DROME Longitudinals lacking protein, isoforms F/I/K/T OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
195582232 671 GD25965 [Drosophila simulans] gi|1941929 0.906 0.144 0.412 1e-15
242016203 272 bric-A-brac, putative [Pediculus humanus 0.785 0.308 0.417 6e-10
157167331 429 bric-a-brac [Aedes aegypti] gi|108882904 0.560 0.139 0.45 1e-09
241701538 448 zinc finger protein, putative [Ixodes sc 0.485 0.116 0.538 2e-09
442759685 441 Putative bric a brac 2 [Ixodes ricinus] 0.719 0.174 0.435 2e-09
345494983 492 PREDICTED: hypothetical protein LOC10012 0.504 0.109 0.555 2e-09
158295170 1095 AGAP006018-PA [Anopheles gambiae str. PE 0.504 0.049 0.481 2e-09
195336475 575 GM14235 [Drosophila sechellia] gi|194127 0.457 0.085 0.490 2e-09
442629331 1066 bric a brac 2, isoform B [Drosophila mel 0.457 0.045 0.490 2e-09
6634127 1067 BAB-II protein [Drosophila melanogaster] 0.457 0.045 0.490 2e-09
>gi|195582232|ref|XP_002080932.1| GD25965 [Drosophila simulans] gi|194192941|gb|EDX06517.1| GD25965 [Drosophila simulans] Back     alignment and taxonomy information
 Score = 87.0 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 65/109 (59%), Gaps = 12/109 (11%)

Query: 10  FCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFF--------- 60
           FC++W N Q  L      LL+ E++VD TL AEG+  +AH+++LSA SP+F         
Sbjct: 7   FCLRWNNHQSTLISVFDTLLENETLVDCTLAAEGKFLKAHKVVLSACSPYFAMDDDQQFC 66

Query: 61  ---QNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFF 106
               N Q  L      LL+ E++VD TL AEG+  +AH+++LSA SP+F
Sbjct: 67  LRWNNHQSTLISVFDTLLENETLVDCTLAAEGKFLKAHKVVLSACSPYF 115




Source: Drosophila simulans

Species: Drosophila simulans

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242016203|ref|XP_002428719.1| bric-A-brac, putative [Pediculus humanus corporis] gi|212513396|gb|EEB15981.1| bric-A-brac, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|157167331|ref|XP_001660259.1| bric-a-brac [Aedes aegypti] gi|108882904|gb|EAT47129.1| AAEL001739-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|241701538|ref|XP_002402860.1| zinc finger protein, putative [Ixodes scapularis] gi|215504895|gb|EEC14389.1| zinc finger protein, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|442759685|gb|JAA72001.1| Putative bric a brac 2 [Ixodes ricinus] Back     alignment and taxonomy information
>gi|345494983|ref|XP_001605103.2| PREDICTED: hypothetical protein LOC100121492 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|158295170|ref|XP_316056.4| AGAP006018-PA [Anopheles gambiae str. PEST] gi|157015906|gb|EAA11698.4| AGAP006018-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195336475|ref|XP_002034861.1| GM14235 [Drosophila sechellia] gi|194127954|gb|EDW49997.1| GM14235 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|442629331|ref|NP_001261242.1| bric a brac 2, isoform B [Drosophila melanogaster] gi|440215109|gb|AGB93937.1| bric a brac 2, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|6634127|emb|CAB64388.1| BAB-II protein [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
FB|FBgn0004870 977 bab1 "bric a brac 1" [Drosophi 0.532 0.058 0.438 8.3e-10
FB|FBgn0025525 1067 bab2 "bric a brac 2" [Drosophi 0.514 0.051 0.490 1.2e-09
FB|FBgn0004652 955 fru "fruitless" [Drosophila me 0.738 0.082 0.395 3.2e-08
FB|FBgn0003254 661 rib "ribbon" [Drosophila melan 0.523 0.084 0.428 3.2e-08
FB|FBgn0003870 813 ttk "tramtrack" [Drosophila me 0.738 0.097 0.372 8.8e-08
FB|FBgn0000210 880 br "broad" [Drosophila melanog 0.495 0.060 0.433 1.2e-07
FB|FBgn0264981 1089 mamo "maternal gene required f 0.747 0.073 0.363 1.6e-07
FB|FBgn0005630 970 lola "longitudinals lacking" [ 0.738 0.081 0.360 1.8e-07
FB|FBgn0022238127 lolal "lola like" [Drosophila 0.542 0.456 0.362 2.3e-07
FB|FBgn0052121 648 CG32121 [Drosophila melanogast 0.495 0.081 0.452 3.7e-07
FB|FBgn0004870 bab1 "bric a brac 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 144 (55.7 bits), Expect = 8.3e-10, Sum P(2) = 8.3e-10
 Identities = 25/57 (43%), Positives = 39/57 (68%)

Query:     5 TTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQ 61
             ++   FC++W N+Q +L     QLL+ E  VDVTL  +G + +AH+++LSA SP+FQ
Sbjct:    97 SSSQQFCLRWNNYQTNLTTIFDQLLQNECFVDVTLACDGRSMKAHKMVLSACSPYFQ 153


GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;TAS
GO:0006351 "transcription, DNA-dependent" evidence=IEP;ISS
GO:0007548 "sex differentiation" evidence=IGI;IMP;TAS
GO:0048071 "sex-specific pigmentation" evidence=TAS
GO:0005515 "protein binding" evidence=IPI
GO:0048092 "negative regulation of male pigmentation" evidence=NAS
GO:0046660 "female sex differentiation" evidence=TAS
GO:0005634 "nucleus" evidence=IDA
GO:0007480 "imaginal disc-derived leg morphogenesis" evidence=IGI;IMP
GO:0008585 "female gonad development" evidence=IGI;IMP
GO:0007455 "eye-antennal disc morphogenesis" evidence=IEP
GO:0003677 "DNA binding" evidence=NAS
GO:0048070 "regulation of developmental pigmentation" evidence=TAS
GO:0048086 "negative regulation of developmental pigmentation" evidence=TAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0003680 "AT DNA binding" evidence=IDA
FB|FBgn0025525 bab2 "bric a brac 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004652 fru "fruitless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0003254 rib "ribbon" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0003870 ttk "tramtrack" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0000210 br "broad" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0264981 mamo "maternal gene required for meiosis" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0005630 lola "longitudinals lacking" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0022238 lolal "lola like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0052121 CG32121 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
pfam00651101 pfam00651, BTB, BTB/POZ domain 8e-08
pfam00651101 pfam00651, BTB, BTB/POZ domain 1e-07
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 4e-05
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 5e-05
>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information
 Score = 46.1 bits (110), Expect = 8e-08
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 25 LYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQN 62
          L +L +   + DVTL    + F AH+ +L+A SP+F+ 
Sbjct: 1  LNELRENGELCDVTLVVGDKEFHAHKAVLAACSPYFKA 38


The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN. Length = 101

>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 107
KOG4441|consensus 571 99.21
PHA02713 557 hypothetical protein; Provisional 99.15
PHA02713 557 hypothetical protein; Provisional 98.9
KOG4441|consensus 571 98.79
KOG0783|consensus 1267 98.53
PHA02790 480 Kelch-like protein; Provisional 98.52
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 98.49
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 98.47
PHA02790 480 Kelch-like protein; Provisional 98.46
KOG4350|consensus 620 98.39
KOG2838|consensus 401 98.35
KOG4350|consensus 620 98.32
PHA03098 534 kelch-like protein; Provisional 98.16
PHA03098 534 kelch-like protein; Provisional 98.13
KOG4591|consensus 280 97.61
KOG2838|consensus 401 97.35
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 97.22
KOG4591|consensus 280 97.17
KOG0783|consensus 1267 96.66
KOG2075|consensus 521 95.92
KOG0511|consensus 516 95.75
KOG0511|consensus 516 94.88
KOG2075|consensus 521 93.24
>KOG4441|consensus Back     alignment and domain information
Probab=99.21  E-value=1.2e-11  Score=92.33  Aligned_cols=61  Identities=26%  Similarity=0.338  Sum_probs=56.4

Q ss_pred             cccCCceEEEEeCchHHHHHHHHHHHHhCCCeeeEEEEeCCeEEeecceeeeccCcccccc
Q psy12932          3 AITTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNF   63 (107)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~Dv~~~~~~~~~~~h~~vl~~~s~~f~~~   63 (107)
                      +........+..+.|...+++.|+.+|+++.+|||++.+++++|+|||.||+++||||++|
T Consensus         5 ~~~~~~~~~~~~~~h~~~~l~~l~~lr~~~~lcDv~L~v~~~~~~aHR~VLAa~S~YFraM   65 (571)
T KOG4441|consen    5 DEIFNSTSEFTDPSHSKFLLQGLNELREEGLLCDVTLLVGDREFPAHRVVLAACSPYFRAM   65 (571)
T ss_pred             ccccccccccccHHHHHHHHHHHHHHHHhCCCceEEEEECCeeechHHHHHHhccHHHHHH
Confidence            3445566788999999999999999999999999999999999999999999999999998



>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4591|consensus Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG4591|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG2075|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG2075|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 1e-09
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 7e-09
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 1e-09
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 1e-08
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 1e-09
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 1e-09
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 2e-09
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 5e-09
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 5e-09
3htm_A 172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 5e-09
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 6e-09
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 5e-08
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 1e-08
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 9e-08
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 1e-08
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 1e-08
3b84_A119 Zinc finger and BTB domain-containing protein 48; 2e-08
3b84_A119 Zinc finger and BTB domain-containing protein 48; 5e-08
2vpk_A116 Myoneurin; transcription regulation, transcription 3e-08
2vpk_A116 Myoneurin; transcription regulation, transcription 3e-08
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 3e-08
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 8e-08
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 3e-08
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 1e-07
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 4e-08
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 4e-08
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 4e-08
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 6e-08
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 1e-07
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 1e-07
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 1e-07
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 1e-07
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 2e-07
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 2e-07
3hqi_A 312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 6e-07
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 7e-07
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 7e-07
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 7e-07
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 3e-06
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 3e-06
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
 Score = 50.7 bits (122), Expect = 1e-09
 Identities = 12/52 (23%), Positives = 24/52 (46%)

Query: 9  NFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFF 60
          +  +++      +   L +L   + + DV +    E F+AH+ +L A S  F
Sbjct: 4  DSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLF 55


>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.51
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.5
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.49
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.47
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.45
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.44
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.44
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.41
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.39
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.39
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.37
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.36
2vpk_A116 Myoneurin; transcription regulation, transcription 99.33
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 99.3
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.29
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.21
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.15
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.14
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.13
2vpk_A116 Myoneurin; transcription regulation, transcription 99.13
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.12
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.12
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.11
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.11
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.1
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.09
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.09
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.08
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.05
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.05
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.03
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.03
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 98.99
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 98.96
3htm_A 172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 98.89
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 98.86
3hqi_A 312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 98.83
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 98.77
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 98.74
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 97.22
4ajy_C97 Transcription elongation factor B polypeptide 1; E 94.0
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 89.46
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
Probab=99.51  E-value=1e-14  Score=88.75  Aligned_cols=62  Identities=27%  Similarity=0.425  Sum_probs=54.7

Q ss_pred             CcccCCceEEEEeCchHHHHHHHHHHHHhCCCeeeEEEEeCCeEEeecceeeeccCcccccc
Q psy12932          2 AAITTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNF   63 (107)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~Dv~~~~~~~~~~~h~~vl~~~s~~f~~~   63 (107)
                      |+..+.+.+.++++++...+++.|++++.++.+|||++.++++.|+|||.||+++|+||+++
T Consensus         1 gp~~~~~~~~~~~~~~~~~l~~~l~~l~~~~~~~Dv~l~v~~~~~~~Hk~vLaa~S~~F~~~   62 (129)
T 3ga1_A            1 GPLGSAQTLQMEIPNFGNSILECLNEQRLQGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDL   62 (129)
T ss_dssp             ------CEEEEECTTHHHHHHHHHHHHHHTTCSCCEEEEETTEEEEECHHHHHHHBHHHHHH
T ss_pred             CCCCCCceEEeecCcHHHHHHHHHHHHHhcCCCcceEEEECCEEEEehHHHHHHcCHHHHHH
Confidence            35567789999999999999999999999999999999999999999999999999999877



>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 107
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 1e-07
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 7e-06
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 5e-07
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 4e-06
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 44.3 bits (104), Expect = 1e-07
 Identities = 12/71 (16%), Positives = 30/71 (42%)

Query: 12 MKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNFQVHLAFEL 71
          +++      +   L +L   + + DV +    E F+AH+ +L A S  F +         
Sbjct: 3  IQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRN 62

Query: 72 YQLLKMESMVD 82
            ++ ++  ++
Sbjct: 63 LSVINLDPEIN 73


>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.54
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.47
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.16
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.11
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.54  E-value=1.3e-15  Score=90.79  Aligned_cols=55  Identities=20%  Similarity=0.347  Sum_probs=52.6

Q ss_pred             eEEEEeCchHHHHHHHHHHHHhCCCeeeEEEEeCCeEEeecceeeeccCcccccc
Q psy12932          9 NFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQNF   63 (107)
Q Consensus         9 ~~~~~~~~~~~~~~~~l~~l~~~~~~~Dv~~~~~~~~~~~h~~vl~~~s~~f~~~   63 (107)
                      .+.+++++|+..+++.|+++|.+|.+||+++.+++++|+|||+||+++|+||+++
T Consensus         3 ~~~~~~~~h~~~ll~~l~~l~~~~~~~Dv~l~v~~~~~~aHk~vLaa~S~~F~~l   57 (121)
T d1buoa_           3 MIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFEIL   57 (121)
T ss_dssp             CCCCCCTTHHHHHHHHHHHHHHHTTTCCEEEEESSCEEEECHHHHHHHCHHHHHH
T ss_pred             eEEEcCCchHHHHHHHHHHHHhcCCcEeEEEEECCEEEEEEHHHhcccChhhhhh
Confidence            5668899999999999999999999999999999999999999999999999887



>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure