Diaphorina citri psyllid: psy12936


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------
ICKYFIEAVENSKYGWFWSCPNGPTCIYKHALPPGFVLKKDKKKEEKKDQISLEDLIERERAALAASSKFTKVTLDSFLAWKKRKLKEKSEAMTKAEEKKRSDFKAGRQVGLSGRDMFSFNPDLAKDDMDEGDEAFDSYTRDEEEDPESNYRELDLDMLLNEAAELDETNISQAKDRVFDTRAGLSR
ccHHHHHHHHcccccccEEccccccccEECcccccccccccHHHHHHHccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHccccccccccccccHHHHHHHHHHccccccccccHHccHHHcccccccc
ICKYFIEAVENSKYGWFWSCPNGPTCIYKHALPPGFVL*****************************SKFTKVTLDSFLAWK********************************RDMFSFNPDLAKDDMDEGDEAFDSYTRDEE**PESNYRELDLDMLLNEAAELDETN*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ICKYFIEAVENSKYGWFWSCPNGPTCIYKHALPPGFVLKKDKKKEEKKDQISLEDLIERERAALAASSKFTKVTLDSFxxxxxxxxxxxxxxxxxxxxxKRSDFKAGRQVGLSGRDMFSFNPDLAKDDMDEGDEAFDSYTRDEEEDPESNYRELDLDMLLNEAAELDETNISQAKDRVFDTRAGLSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger CCCH domain-containing protein 15 Protects drg1 from proteolytic degradation.confidentQ803J8
Zinc finger CCCH domain-containing protein 15 Protects DRG1 from proteolytic degradation.confidentQ8WU90
Zinc finger CCCH domain-containing protein 15 homolog confidentQ7JWR9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043229 [CC]intracellular organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A9A, chain C
Confidence level:confident
Coverage over the Query: 45-116,135-142
View the alignment between query and template
View the model in PyMOL
Template: 1M9O, chain A
Confidence level:probable
Coverage over the Query: 1-34
View the alignment between query and template
View the model in PyMOL