Diaphorina citri psyllid: psy12937


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MLRRSSYSGYLPCLFQSGAKCKFSHDLTIERKAEKRSLYVDMRDDGEDVNETMENWDEDKLKEVVEKKHGEAEKKRPTTTIICKYFIEAVENSKYGWFWSCPNGPCTFENG
ccccccccccccCECcccccccccccccHHHHHHHHHHHHcccccccccHHHHccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccEEEEccccccccccc
*****SYSGYLPCLFQSGAKCKFSHDLTIERKAEKRSLYVDM**************DEDKL*****************TTIICKYFIEAVENSKYGWFWSCPNGPCTF***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRRSSYSGYLPCLFQSGAKCKFSHDLTIERKAEKRSLYVDMRDDGEDVNETMENWDEDKLKEVVEKKHGEAEKKRPTTTIICKYFIEAVENSKYGWFWSCPNGPCTFENG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger CCCH domain-containing protein 15 Protects drg1 from proteolytic degradation.confidentQ803J8
Zinc finger CCCH domain-containing protein 15 Protects DRG1 from proteolytic degradation.confidentQ8WU90
Zinc finger CCCH domain-containing protein 15 Protects drg1 from proteolytic degradation.confidentA4IGY3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0019221 [BP]cytokine-mediated signaling pathwayprobableGO:0044700, GO:0051716, GO:0034097, GO:0008150, GO:0071345, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0050789, GO:0071310, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0042221, GO:0007154, GO:0070887, GO:0010033, GO:0044699
GO:0042788 [CC]polysomal ribosomeprobableGO:0005737, GO:0005844, GO:0032991, GO:0005840, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E5S, chain A
Confidence level:probable
Coverage over the Query: 77-89,100-111
View the alignment between query and template
View the model in PyMOL
Template: 2D9N, chain A
Confidence level:probable
Coverage over the Query: 10-29
View the alignment between query and template
View the model in PyMOL
Template: 3U9G, chain A
Confidence level:probable
Coverage over the Query: 17-110
View the alignment between query and template
View the model in PyMOL