Diaphorina citri psyllid: psy1295


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MSTFLYFQTNEEPAVNPKAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEPLEIVLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIIACSVTVDEGSQLKPQIQAIQQQIERLLI
ccccccEEccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccEEEEEEcccccHHHHHcHHHHHHcccccEEEEccHHHHHHHccccccCEEEEEECccccccHHHHHHHHHHHHHHcc
****LYFQTNEEPAVNPKAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEPLEIVLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIIACSVTVDEGSQLKPQIQAIQQQIERLLI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTFLYFQTNEEPAVNPKAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEPLEIVLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIIACSVTVDEGSQLKPQIQAIQQQIERLLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NHP2-like protein 1 Binds to the 5'-stem-loop of U4 snRNA and may play a role in the late stage of spliceosome assembly. The protein undergoes a conformational change upon RNA-binding.very confidentQ6P8E9
NHP2-like protein 1 Binds to the 5'-stem-loop of U4 snRNA and may play a role in the late stage of spliceosome assembly. The protein undergoes a conformational change upon RNA-binding.very confidentP55770
13 kDa ribonucleoprotein-associated protein Common component of the spliceosome and rRNA processing machinery. In association with the spliceosomal U4/U6.U5 tri-snRNP particle, required for splicing of pre-mRNA. In association with box C/D snoRNPs, required for processing of pre-ribosomal RNA (rRNA) and site-specific 2'-O-methylation of substrate RNAs. Essential for the accumulation and stability of U4 snRNA, U6 snRNA, and box C/D snoRNAs.very confidentP0CQ52

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030515 [MF]snoRNA bindingconfidentGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0071011 [CC]precatalytic spliceosomeconfidentGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0009792 [BP]embryo development ending in birth or egg hatchingconfidentGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0005654 [CC]nucleoplasmconfidentGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0046540 [CC]U4/U6 x U5 tri-snRNP complexconfidentGO:0005575, GO:0032991, GO:0043231, GO:0030532, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0032040 [CC]small-subunit processomeconfidentGO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0007422 [BP]peripheral nervous system developmentconfidentGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0002119 [BP]nematode larval developmentconfidentGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0007338 [BP]single fertilizationconfidentGO:0044702, GO:0000003, GO:0009566, GO:0019953, GO:0022414, GO:0008150, GO:0044699
GO:0010171 [BP]body morphogenesisconfidentGO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0031428 [CC]box C/D snoRNP complexconfidentGO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0044446, GO:0005732, GO:0031981, GO:0005730, GO:0005634, GO:0030529, GO:0044452, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0030490 [BP]maturation of SSU-rRNAconfidentGO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:0071840, GO:0006139, GO:0044260, GO:0042274, GO:1901360, GO:0042254, GO:0071704, GO:0010467, GO:0006364, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0045292 [BP]mRNA cis splicing, via spliceosomeconfidentGO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000398, GO:0043170, GO:0006396, GO:0006397
GO:0005515 [MF]protein bindingconfidentGO:0003674, GO:0005488
GO:0040007 [BP]growthconfidentGO:0008150
GO:0006898 [BP]receptor-mediated endocytosisconfidentGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0043581 [BP]mycelium developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0000462 [BP]maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)probableGO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0042274, GO:0071840, GO:0042254, GO:0071704, GO:0010467, GO:0006364, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0030490, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0006412 [BP]translationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0003735 [MF]structural constituent of ribosomeprobableGO:0003674, GO:0005198
GO:0022625 [CC]cytosolic large ribosomal subunitprobableGO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0043226, GO:0044424, GO:0015934, GO:0043228, GO:0030529, GO:0032991, GO:0044422
GO:0009451 [BP]RNA modificationprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0043412, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0016020 [CC]membraneprobableGO:0005575
GO:0044351 [BP]macropinocytosisprobableGO:0006897, GO:0016192, GO:0006907, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JNB, chain A
Confidence level:very confident
Coverage over the Query: 13-137
View the alignment between query and template
View the model in PyMOL