Psyllid ID: psy1295

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MSTFLYFQTNEEPAVNPKAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEPLEIVLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIIACSVTVDEGSQLKPQIQAIQQQIERLLI
ccccccEEccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccEEEEEEcccccHHHHHcHHHHHHHccccEEEEccHHHHHHHHcccccEEEEEEEEccccccHHHHHHHHHHHHHHcc
ccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHccEEEcHHHHHHHHHHccccEEEEEcccccHHHcccHHHHHHcccccEEEEccHHHHHHHccccccccEEEEcccccHHHHHHHHHHHHHHHHHcc
mstflyfqtneepavnpkaypladtALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEPLEIVLHlpllcedknvpyvFVRSKqalgracgvsrpiiacsvtvdegsqlkPQIQAIQQQIERLLI
mstflyfqtneepavnpkAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEPLEIVLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIIACSVtvdegsqlkpQIQAIQQQIERLLI
MSTFLYFQTNEEPAVNPKAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEPLEIVLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIIACSVTVDEGSQLKPqiqaiqqqiERLLI
****LYFQ******VNPKAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEPLEIVLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIIACSVTVDE********************
****LY**TNEEPAVNPKAYPLADTALTTKILSLVQQALN**QLRKGANEATKTLNRGLSEFIVLAADAEPLEIVLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIIACSVTVDEGSQLKPQIQAIQQQIERLLI
MSTFLYFQTNEEPAVNPKAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEPLEIVLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIIACSVTVDEGSQLKPQIQAIQQQIERLLI
MSTFLYFQTNEEPAVNPKAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEPLEIVLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIIACSVTVDEGSQLKPQIQAIQQQIERLLI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTFLYFQTNEEPAVNPKAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEPLEIVLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIIACSVTVDEGSQLKPQIQAIQQQIERLLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query137 2.2.26 [Sep-21-2011]
Q5XH16128 NHP2-like protein 1 OS=Xe N/A N/A 0.919 0.984 0.841 2e-59
Q6P8E9128 NHP2-like protein 1 OS=Xe yes N/A 0.919 0.984 0.841 3e-59
Q9U3Z7127 NHP2-like protein 1 homol yes N/A 0.897 0.968 0.813 8e-56
P55770128 NHP2-like protein 1 OS=Ra yes N/A 0.919 0.984 0.849 8e-54
Q9D0T1128 NHP2-like protein 1 OS=Mu yes N/A 0.919 0.984 0.849 8e-54
Q4R5C6128 NHP2-like protein 1 OS=Ma N/A N/A 0.919 0.984 0.849 8e-54
P55769128 NHP2-like protein 1 OS=Ho yes N/A 0.919 0.984 0.849 8e-54
Q3B8S0128 NHP2-like protein 1 OS=Bo yes N/A 0.919 0.984 0.849 8e-54
O74690125 13 kDa ribonucleoprotein- yes N/A 0.905 0.992 0.766 4e-51
Q4P0K3126 13 kDa ribonucleoprotein- N/A N/A 0.905 0.984 0.725 2e-48
>sp|Q5XH16|NH2L1_XENLA NHP2-like protein 1 OS=Xenopus laevis GN=nhp2l1 PE=2 SV=1 Back     alignment and function desciption
 Score =  226 bits (577), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 117/126 (92%)

Query: 12  EPAVNPKAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEP 71
           EP VNPKAYPLAD  LT  +L LVQQ+ NYKQLRKGANEATKTLNRG++EFIV+AADAEP
Sbjct: 3   EPEVNPKAYPLADAQLTKTLLDLVQQSANYKQLRKGANEATKTLNRGIAEFIVMAADAEP 62

Query: 72  LEIVLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIIACSVTVDEGSQLKPQIQAIQQQ 131
           LEI+LHLPLLCEDKNVPYVFVRSKQALGRACGVSRP+IACSVT+ EGSQLKPQIQ++QQ 
Sbjct: 63  LEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKPQIQSVQQA 122

Query: 132 IERLLI 137
           IERLL+
Sbjct: 123 IERLLV 128
Binds to the 5'-stem-loop of U4 snRNA and may play a role in the late stage of spliceosome assembly. The protein undergoes a conformational change upon RNA-binding.
Xenopus laevis (taxid: 8355)
>sp|Q6P8E9|NH2L1_XENTR NHP2-like protein 1 OS=Xenopus tropicalis GN=nhp2l1 PE=2 SV=1 Back     alignment and function description
>sp|Q9U3Z7|NH2L1_DROME NHP2-like protein 1 homolog OS=Drosophila melanogaster GN=hoip PE=2 SV=1 Back     alignment and function description
>sp|P55770|NH2L1_RAT NHP2-like protein 1 OS=Rattus norvegicus GN=Nhp2l1 PE=2 SV=4 Back     alignment and function description
>sp|Q9D0T1|NH2L1_MOUSE NHP2-like protein 1 OS=Mus musculus GN=Nhp2l1 PE=2 SV=4 Back     alignment and function description
>sp|Q4R5C6|NH2L1_MACFA NHP2-like protein 1 OS=Macaca fascicularis GN=NHP2L1 PE=2 SV=1 Back     alignment and function description
>sp|P55769|NH2L1_HUMAN NHP2-like protein 1 OS=Homo sapiens GN=NHP2L1 PE=1 SV=3 Back     alignment and function description
>sp|Q3B8S0|NH2L1_BOVIN NHP2-like protein 1 OS=Bos taurus GN=NHP2L1 PE=2 SV=3 Back     alignment and function description
>sp|O74690|SNU13_SCHPO 13 kDa ribonucleoprotein-associated protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snu13 PE=3 SV=1 Back     alignment and function description
>sp|Q4P0K3|SNU13_USTMA 13 kDa ribonucleoprotein-associated protein OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SNU13 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query137
389609205130 ribosomal protein l7ae [Papilio xuthus] 0.919 0.969 0.873 1e-60
357625055130 ribosomal protein L7Ae [Danaus plexippus 0.919 0.969 0.865 3e-60
312376824160 hypothetical protein AND_12217 [Anophele 0.970 0.831 0.816 2e-59
342356313130 non-histone chromosome protein 2 [Helico 0.919 0.969 0.857 3e-59
114052793130 ribosomal protein L7Ae [Bombyx mori] gi| 0.919 0.969 0.865 3e-59
315115331130 non-histone chromosome protein 2 [Euphyd 0.934 0.984 0.835 1e-58
157135810127 ribosomal protein l7ae [Aedes aegypti] g 0.897 0.968 0.861 7e-58
147906322128 NHP2 non-histone chromosome protein 2-li 0.919 0.984 0.849 8e-58
334349567128 PREDICTED: NHP2-like protein 1-like [Mon 0.919 0.984 0.849 9e-58
158296990128 AGAP008163-PA [Anopheles gambiae str. PE 0.927 0.992 0.830 1e-57
>gi|389609205|dbj|BAM18214.1| ribosomal protein l7ae [Papilio xuthus] Back     alignment and taxonomy information
 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 122/126 (96%)

Query: 12  EPAVNPKAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEP 71
           EPAVNPKAYPLAD ALT KIL+LVQQA NYKQLRKGANEATKTLNRGLSEF+++AADAEP
Sbjct: 5   EPAVNPKAYPLADAALTAKILNLVQQAANYKQLRKGANEATKTLNRGLSEFVIMAADAEP 64

Query: 72  LEIVLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIIACSVTVDEGSQLKPQIQAIQQQ 131
           LEIVLH+P+LCEDKNVPYVFVRSKQALGRACGVSRPI+ACS+T++EGSQLKPQIQ IQQ+
Sbjct: 65  LEIVLHIPILCEDKNVPYVFVRSKQALGRACGVSRPIVACSITINEGSQLKPQIQGIQQE 124

Query: 132 IERLLI 137
           IERLL+
Sbjct: 125 IERLLV 130

Source: Papilio xuthus

Species: Papilio xuthus

Genus: Papilio

Family: Papilionidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|357625055|gb|EHJ75608.1| ribosomal protein L7Ae [Danaus plexippus] Back     alignment and taxonomy information
>gi|312376824|gb|EFR23806.1| hypothetical protein AND_12217 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|342356313|gb|AEL28815.1| non-histone chromosome protein 2 [Heliconius melpomene cythera] Back     alignment and taxonomy information
>gi|114052793|ref|NP_001040276.1| ribosomal protein L7Ae [Bombyx mori] gi|87248593|gb|ABD36349.1| ribosomal protein L7Ae [Bombyx mori] Back     alignment and taxonomy information
>gi|315115331|gb|ADT80638.1| non-histone chromosome protein 2 [Euphydryas aurinia] Back     alignment and taxonomy information
>gi|157135810|ref|XP_001656680.1| ribosomal protein l7ae [Aedes aegypti] gi|170040078|ref|XP_001847839.1| 13 kDa ribonucleoprotein-associated protein [Culex quinquefasciatus] gi|94469036|gb|ABF18367.1| 60S ribosomal protein 15.5kD/SNU13 [Aedes aegypti] gi|108881137|gb|EAT45362.1| AAEL003352-PA [Aedes aegypti] gi|167863651|gb|EDS27034.1| 13 kDa ribonucleoprotein-associated protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|147906322|ref|NP_001080724.1| NHP2 non-histone chromosome protein 2-like 1 [Xenopus laevis] gi|28302201|gb|AAH46579.1| Hoip-prov protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|334349567|ref|XP_001378787.2| PREDICTED: NHP2-like protein 1-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|158296990|ref|XP_317299.3| AGAP008163-PA [Anopheles gambiae str. PEST] gi|157014979|gb|EAA12564.4| AGAP008163-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query137
UNIPROTKB|B1AHD1132 NHP2L1 "NHP2-like protein 1" [ 0.956 0.992 0.774 5.2e-49
UNIPROTKB|F1NII6144 NHP2L1 "Uncharacterized protei 0.919 0.875 0.777 6.7e-49
UNIPROTKB|Q3B8S0128 NHP2L1 "NHP2-like protein 1" [ 0.919 0.984 0.793 6.7e-49
UNIPROTKB|E2RRM7128 NHP2L1 "Uncharacterized protei 0.919 0.984 0.793 6.7e-49
UNIPROTKB|P55769128 NHP2L1 "NHP2-like protein 1" [ 0.919 0.984 0.793 6.7e-49
UNIPROTKB|F2Z5V3128 NHP2L1 "Uncharacterized protei 0.919 0.984 0.793 6.7e-49
RGD|1303103128 Nhp2l1 "NHP2 non-histone chrom 0.919 0.984 0.793 6.7e-49
ZFIN|ZDB-GENE-030131-9670128 nhp2l1b "NHP2 non-histone chro 0.919 0.984 0.793 2.3e-48
ZFIN|ZDB-GENE-040426-879128 nhp2l1a "NHP2 non-histone chro 0.919 0.984 0.793 2.3e-48
UNIPROTKB|J9P8E9128 LOC609886 "Uncharacterized pro 0.919 0.984 0.777 1.2e-47
UNIPROTKB|B1AHD1 NHP2L1 "NHP2-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 511 (184.9 bits), Expect = 5.2e-49, P = 5.2e-49
 Identities = 103/133 (77%), Positives = 111/133 (83%)

Query:     5 LYFQTNEEPAVNPKAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIV 64
             L  QT  E  VNPKAYPLAD  LT K+L LVQQ+ NYKQLRKGANEATKTLNRG+SEFIV
Sbjct:     2 LLVQT--EADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIV 59

Query:    65 LAADAEPLEIVLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIIACSVTVDEGSQLKPX 124
             +AADAEPLEI+LHLPLLCEDKNVPYVFVRSKQALGRACGVSRP+IACSVT+ EGSQLK  
Sbjct:    60 MAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQ 119

Query:   125 XXXXXXXXERLLI 137
                     ERLL+
Sbjct:   120 IQSIQQSIERLLV 132
GO:0003723 "RNA binding" evidence=IEA
GO:0005730 "nucleolus" evidence=IEA
GO:0030529 "ribonucleoprotein complex" evidence=IEA
GO:0042254 "ribosome biogenesis" evidence=IEA
UNIPROTKB|F1NII6 NHP2L1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3B8S0 NHP2L1 "NHP2-like protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RRM7 NHP2L1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P55769 NHP2L1 "NHP2-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5V3 NHP2L1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1303103 Nhp2l1 "NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-9670 nhp2l1b "NHP2 non-histone chromosome protein 2-like 1b (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-879 nhp2l1a "NHP2 non-histone chromosome protein 2-like 1a (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J9P8E9 LOC609886 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6P8E9NH2L1_XENTRNo assigned EC number0.84120.91970.9843yesN/A
P55770NH2L1_RATNo assigned EC number0.84920.91970.9843yesN/A
P0CQ52SNU13_CRYNJNo assigned EC number0.72130.89050.9606yesN/A
Q6BLQ3SNU13_DEBHANo assigned EC number0.72580.90510.9841yesN/A
Q5JGR3RL7A_PYRKONo assigned EC number0.40.78830.8780yesN/A
Q4J8P1RL7A_SULACNo assigned EC number0.39440.78100.8492yesN/A
P0CQ53SNU13_CRYNBNo assigned EC number0.72130.89050.9606N/AN/A
Q54ST0NH2L1_DICDINo assigned EC number0.64750.89050.9457yesN/A
Q6CM69SNU13_KLULANo assigned EC number0.69350.90510.9841yesN/A
Q97BK8RL7A_THEVONo assigned EC number0.40740.73720.8347yesN/A
B1Y9V4RL7A_PYRNVNo assigned EC number0.39820.79560.7218yesN/A
Q5XH16NH2L1_XENLANo assigned EC number0.84120.91970.9843N/AN/A
A8A912RL7A_IGNH4No assigned EC number0.40860.66420.7109yesN/A
P39990SNU13_YEASTNo assigned EC number0.70960.90510.9841yesN/A
P55769NH2L1_HUMANNo assigned EC number0.84920.91970.9843yesN/A
Q5ANL6SNU13_CANALNo assigned EC number0.71770.90510.9841N/AN/A
Q3B8S0NH2L1_BOVINNo assigned EC number0.84920.91970.9843yesN/A
Q4P0K3SNU13_USTMANo assigned EC number0.72580.90510.9841N/AN/A
Q4R5C6NH2L1_MACFANo assigned EC number0.84920.91970.9843N/AN/A
Q9YAX7RL7A_AERPENo assigned EC number0.39440.78100.8425yesN/A
O29494RL7A_ARCFUNo assigned EC number0.41280.78100.8991yesN/A
Q21568NH2L1_CAEELNo assigned EC number0.76190.91970.9843yesN/A
O74690SNU13_SCHPONo assigned EC number0.76610.90510.992yesN/A
Q971C9RL7A_SULTONo assigned EC number0.42200.78100.8492yesN/A
Q6FQV5SNU13_CANGANo assigned EC number0.69350.90510.9841yesN/A
A3DMR6RL7A_STAMFNo assigned EC number0.37270.78100.8359yesN/A
Q757T2SNU13_ASHGONo assigned EC number0.71310.89050.9606yesN/A
Q9U3Z7NH2L1_DROMENo assigned EC number0.81300.89780.9685yesN/A
Q6C0I0SNU13_YARLINo assigned EC number0.72950.89050.9682yesN/A
Q8ZTA5RL7A_PYRAENo assigned EC number0.40350.78100.7086yesN/A
B6YWH9RL7A_THEONNo assigned EC number0.39090.78830.8780yesN/A
Q9D0T1NH2L1_MOUSENo assigned EC number0.84920.91970.9843yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query137
COG1358116 COG1358, RPL8A, Ribosomal protein HS6-type (S12/L3 3e-32
pfam0124895 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/ 2e-31
PRK04175122 PRK04175, rpl7ae, 50S ribosomal protein L7Ae; Vali 2e-29
TIGR03677117 TIGR03677, rpl7ae, 50S ribosomal protein L7Ae 4e-29
PTZ00365266 PTZ00365, PTZ00365, 60S ribosomal protein L7Ae-lik 6e-08
PTZ00222263 PTZ00222, PTZ00222, 60S ribosomal protein L7a; Pro 1e-07
PRK1360282 PRK13602, PRK13602, putative ribosomal protein L7A 4e-06
>gnl|CDD|224277 COG1358, RPL8A, Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score =  110 bits (276), Expect = 3e-32
 Identities = 47/115 (40%), Positives = 69/115 (60%), Gaps = 3/115 (2%)

Query: 18  KAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEPLEIVLH 77
            A PLA   L  K LSL+ +A    +L+KG NE TK + RG ++ +V+A D  P E+V H
Sbjct: 2   YAKPLAPEMLEQKALSLLGKASRAGKLKKGTNEVTKAIERGKAKLVVIAEDVSPEELVKH 61

Query: 78  LPLLCEDKNVPYVFVRSKQALGRACGV-SRPIIACSVTV--DEGSQLKPQIQAIQ 129
           LP LCE+KNVPYV+V SK+ LG+A G   R ++A        +   L  +++ ++
Sbjct: 62  LPALCEEKNVPYVYVGSKKELGKAVGKEVRKVVAIVDKGFAKKLEDLVEKVEELK 116

Length = 116
>gnl|CDD|216387 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/L30e/S12e/Gadd45 family Back     alignment and domain information
>gnl|CDD|179766 PRK04175, rpl7ae, 50S ribosomal protein L7Ae; Validated Back     alignment and domain information
>gnl|CDD|188367 TIGR03677, rpl7ae, 50S ribosomal protein L7Ae Back     alignment and domain information
>gnl|CDD|240382 PTZ00365, PTZ00365, 60S ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>gnl|CDD|140249 PTZ00222, PTZ00222, 60S ribosomal protein L7a; Provisional Back     alignment and domain information
>gnl|CDD|184174 PRK13602, PRK13602, putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 137
TIGR03677117 rpl7ae 50S ribosomal protein L7Ae. Multifunctional 99.96
PRK04175122 rpl7ae 50S ribosomal protein L7Ae; Validated 99.96
COG1358116 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Tr 99.94
KOG3167|consensus153 99.94
PTZ00106108 60S ribosomal protein L30; Provisional 99.91
PRK07714100 hypothetical protein; Provisional 99.91
PRK0101899 50S ribosomal protein L30e; Reviewed 99.9
PRK0728398 hypothetical protein; Provisional 99.89
PRK1360282 putative ribosomal protein L7Ae-like; Provisional 99.89
PRK0668382 hypothetical protein; Provisional 99.89
PRK05583104 ribosomal protein L7Ae family protein; Provisional 99.89
PF0124895 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/G 99.89
PRK1360182 putative L7Ae-like ribosomal protein; Provisional 99.87
KOG3387|consensus131 99.87
PRK1360084 putative ribosomal protein L7Ae-like; Provisional 99.85
PRK09190220 hypothetical protein; Provisional 99.8
PTZ00222263 60S ribosomal protein L7a; Provisional 99.8
PTZ00365266 60S ribosomal protein L7Ae-like; Provisional 99.77
COG1911100 RPL30 Ribosomal protein L30E [Translation, ribosom 99.76
KOG3406|consensus134 99.74
KOG2988|consensus112 98.97
PF08228158 RNase_P_pop3: RNase P subunit Pop3; InterPro: IPR0 98.08
KOG3166|consensus209 97.6
PF0803276 SpoU_sub_bind: RNA 2'-O ribose methyltransferase s 96.04
PF03465113 eRF1_3: eRF1 domain 3; InterPro: IPR005142 This do 96.02
PF15608100 PELOTA_1: PELOTA RNA binding domain 94.94
PRK04011411 peptide chain release factor 1; Provisional 94.76
TIGR03676403 aRF1/eRF1 peptide chain release factor 1, archaeal 94.6
TIGR00111351 pelota probable translation factor pelota. This mo 94.45
TIGR00108409 eRF peptide chain release factor eRF/aRF, subunit 94.13
PF1008797 DUF2325: Uncharacterized protein conserved in bact 93.71
PRK10864 346 putative methyltransferase; Provisional 91.67
cd01422115 MGS Methylglyoxal synthase catalyzes the enolizati 88.59
TIGR00186 237 rRNA_methyl_3 rRNA methylase, putative, group 3. t 87.66
PRK11181 244 23S rRNA (guanosine-2'-O-)-methyltransferase; Prov 87.09
PF07997120 DUF1694: Protein of unknown function (DUF1694); In 86.62
PLN02821460 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate red 86.19
cd01020264 TroA_b Metal binding protein TroA_b. These protein 85.94
PF0214295 MGS: MGS-like domain This is a subfamily of this f 85.19
PRK05234142 mgsA methylglyoxal synthase; Validated 83.55
PF03618 255 Kinase-PPPase: Kinase/pyrophosphorylase; InterPro: 82.99
PF13727175 CoA_binding_3: CoA-binding domain; PDB: 3NKL_B. 82.45
cd00532112 MGS-like MGS-like domain. This domain composes the 82.44
PRK13371387 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 81.64
>TIGR03677 rpl7ae 50S ribosomal protein L7Ae Back     alignment and domain information 
Probab=99.96  E-value=9.6e-29  Score=178.56  Aligned_cols=116  Identities=34%  Similarity=0.645  Sum_probs=105.2

Q ss_pred             cccCCCCChHHHHHHHHHHHHHHHcCCccccHHHHHHHHHcCcccEEEEecCCChhhHHHhHHHHhHhcCCCEEEeCCHH
Q psy1295          17 PKAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEPLEIVLHLPLLCEDKNVPYVFVRSKQ   96 (137)
Q Consensus        17 ~~~~p~a~~~~~~kl~~lL~~A~~ag~lv~G~~~v~kaI~k~kaklViiA~D~~~~~~~~~i~~lc~~~~IP~i~~~tk~   96 (137)
                      |..+|.++. ++++++++|++|+++|++++|.++|+++|++|++++||+|+|++|++++++++.+|++++|||++++|+.
T Consensus         1 ~~~~~~~~~-l~~ki~~lL~la~ragkl~~G~~~v~kaikkgka~LVilA~D~s~~~~~~~i~~lc~~~~Ip~~~~~sk~   79 (117)
T TIGR03677         1 YVKFEVPEE-LANKALEAVEKARETGKIKKGTNEVTKAVERGIAKLVVIAEDVEPPEIVAHLPALCEEKGIPYVYVKKKE   79 (117)
T ss_pred             CCCCcCcHH-HHHHHHHHHHHHHHcCCEeEcHHHHHHHHHcCCccEEEEeCCCCcHHHHHHHHHHHHHcCCCEEEeCCHH
Confidence            457888666 9999999999999999999999999999999999999999999997689999999999999999999999


Q ss_pred             HHHHHhCCCcceEEEEEEeCCCCChHHHHHHHHHHHHHh
Q psy1295          97 ALGRACGVSRPIIACSVTVDEGSQLKPQIQAIQQQIERL  135 (137)
Q Consensus        97 eLG~a~G~~~~v~~~ai~~~~~s~~~~~i~e~~~~~~~~  135 (137)
                      +||++||+++++++++|.+  .+....+++++..+|++|
T Consensus        80 eLG~a~Gk~~~~svvaI~d--~g~a~~~~~~~~~~i~~~  116 (117)
T TIGR03677        80 DLGAAAGLEVGAASAAIVD--EGKAEELLKEIIEKVEAL  116 (117)
T ss_pred             HHHHHhCCCCCeEEEEEEc--hhhhHHHHHHHHHHHHhc
Confidence            9999999987777767654  456677899999999886

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, box H/ACA, box C/D and box C'/D' sRNAs. Interacts with protein L15e.
>PRK04175 rpl7ae 50S ribosomal protein L7Ae; Validated Back     alignment and domain information
>COG1358 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3167|consensus Back     alignment and domain information
>PTZ00106 60S ribosomal protein L30; Provisional Back     alignment and domain information
>PRK07714 hypothetical protein; Provisional Back     alignment and domain information
>PRK01018 50S ribosomal protein L30e; Reviewed Back     alignment and domain information
>PRK07283 hypothetical protein; Provisional Back     alignment and domain information
>PRK13602 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>PRK06683 hypothetical protein; Provisional Back     alignment and domain information
>PRK05583 ribosomal protein L7Ae family protein; Provisional Back     alignment and domain information
>PF01248 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family; InterPro: IPR004038 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK13601 putative L7Ae-like ribosomal protein; Provisional Back     alignment and domain information
>KOG3387|consensus Back     alignment and domain information
>PRK13600 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>PRK09190 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00222 60S ribosomal protein L7a; Provisional Back     alignment and domain information
>PTZ00365 60S ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>COG1911 RPL30 Ribosomal protein L30E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3406|consensus Back     alignment and domain information
>KOG2988|consensus Back     alignment and domain information
>PF08228 RNase_P_pop3: RNase P subunit Pop3; InterPro: IPR013241 This family of fungal proteins form a subunit of RNase P, the ribonucleoprotein enzyme that cleaves the leader sequence of precursor tRNAs to generate mature tRNAs Back     alignment and domain information
>KOG3166|consensus Back     alignment and domain information
>PF08032 SpoU_sub_bind: RNA 2'-O ribose methyltransferase substrate binding; InterPro: IPR013123 Most cellular RNAs undergo a number of post-transcriptional nucleoside modifications Back     alignment and domain information
>PF03465 eRF1_3: eRF1 domain 3; InterPro: IPR005142 This domain is found in the release factor eRF1 which terminates protein biosynthesis by recognizing stop codons at the A site of the ribosome and stimulating peptidyl-tRNA bond hydrolysis at the peptidyl transferase centre Back     alignment and domain information
>PF15608 PELOTA_1: PELOTA RNA binding domain Back     alignment and domain information
>PRK04011 peptide chain release factor 1; Provisional Back     alignment and domain information
>TIGR03676 aRF1/eRF1 peptide chain release factor 1, archaeal and eukaryotic forms Back     alignment and domain information
>TIGR00111 pelota probable translation factor pelota Back     alignment and domain information
>TIGR00108 eRF peptide chain release factor eRF/aRF, subunit 1 Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK10864 putative methyltransferase; Provisional Back     alignment and domain information
>cd01422 MGS Methylglyoxal synthase catalyzes the enolization of dihydroxyacetone phosphate (DHAP) to produce methylglyoxal Back     alignment and domain information
>TIGR00186 rRNA_methyl_3 rRNA methylase, putative, group 3 Back     alignment and domain information
>PRK11181 23S rRNA (guanosine-2'-O-)-methyltransferase; Provisional Back     alignment and domain information
>PF07997 DUF1694: Protein of unknown function (DUF1694); InterPro: IPR012543 This family contains many hypothetical proteins Back     alignment and domain information
>PLN02821 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase Back     alignment and domain information
>cd01020 TroA_b Metal binding protein TroA_b Back     alignment and domain information
>PF02142 MGS: MGS-like domain This is a subfamily of this family; InterPro: IPR011607 This domain composes the whole protein of methylglyoxal synthetase and the domain is also found in carbamoyl phosphate synthetase (CPS) where it forms a regulatory domain that binds to the allosteric effector ornithine Back     alignment and domain information
>PRK05234 mgsA methylglyoxal synthase; Validated Back     alignment and domain information
>PF03618 Kinase-PPPase: Kinase/pyrophosphorylase; InterPro: IPR005177 This entry represents a family of uncharacterised proteins which are predicted to function as phosphotransferases Back     alignment and domain information
>PF13727 CoA_binding_3: CoA-binding domain; PDB: 3NKL_B Back     alignment and domain information
>cd00532 MGS-like MGS-like domain Back     alignment and domain information
>PRK13371 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query137
2jnb_A144 Solution Structure Of Rna-Binding Protein 15.5k Len 1e-54
2ozb_A130 Structure Of A Human Prp31-15.5k-U4 Snrna Complex L 2e-54
1e7k_A128 Crystal Structure Of The Spliceosomal 15.5kd Protei 2e-54
1zwz_A126 Structural Comparison Of Yeast Snornp And Splicesom 7e-45
2ale_A134 Crystal Structure Of Yeast Rna Splicing Factor Snu1 8e-45
2aif_A135 Crystal Structure Of High Mobility Like Protein, Nh 1e-44
3o85_A122 Giardia Lamblia 15.5kd Rna Binding Protein Length = 5e-26
3paf_A117 M. Jannaschii L7ae Mutant Length = 117 5e-20
1rlg_A119 Molecular Basis Of Box CD RNA-Protein Interaction: 6e-20
3id5_C130 Crystal Structure Of Sulfolobus Solfataricus CD RNP 1e-19
2fc3_A124 Crystal Structure Of The Extremely Thermostable Aer 2e-18
1ra4_A120 Crystal Structure Of The Methanococcus Jannaschii L 5e-17
1sds_A117 Structure Of Protein L7ae Bound To A K-Turn Derived 5e-17
2lbx_A121 Solution Structure Of The S. Cerevisiae HACA RNP PR 8e-16
2lbw_A121 Solution Structure Of The S. Cerevisiae HACA RNP PR 1e-15
1pxw_A128 Crystal Structure Of L7ae Srnp Core Protein From Py 2e-15
3lwo_C123 Structure Of HACA RNP BOUND TO A SUBSTRATE RNA CONT 2e-15
3nmu_C129 Crystal Structure Of Substrate-Bound Halfmer Box CD 2e-15
2hvy_D130 Crystal Structure Of An HACA BOX RNP FROM PYROCOCCU 2e-15
2czw_A124 Crystal Structure Analysis Of Protein Component Ph1 2e-15
3hjw_C120 Structure Of A Functional Ribonucleoprotein Pseudou 2e-15
1s72_F120 Refined Crystal Structure Of The Haloarcula Marismo 1e-14
3g4s_F119 Co-Crystal Structure Of Tiamulin Bound To The Large 1e-14
1ffk_E119 Crystal Structure Of The Large Ribosomal Subunit Fr 1e-13
4a17_F255 T.Thermophila 60s Ribosomal Subunit In Complex With 8e-08
3zf7_x276 High-resolution Cryo-electron Microscopy Structure 2e-07
3izr_H258 Localization Of The Large Subunit Ribosomal Protein 7e-07
2zkr_f266 Structure Of A Mammalian Ribosomal 60s Subunit With 1e-06
3jyw_G113 Structure Of The 60s Proteins For Eukaryotic Riboso 4e-05
1s1i_G119 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 4e-05
3izs_H256 Localization Of The Large Subunit Ribosomal Protein 6e-05
3v7e_A82 Crystal Structure Of Ybxf Bound To The Sam-I Ribosw 9e-05
>pdb|2JNB|A Chain A, Solution Structure Of Rna-Binding Protein 15.5k Length = 144 Back     alignment and structure 
Iteration: 1

 Score =  207 bits (527), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 108/126 (85%)
Query: 12  EPAVNPKAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEP 71
           E  VNPKAYPLAD  LT K+L LVQQ+ NYKQLRKGANEATKTLNRG+SEFIV+AADAEP
Sbjct: 19  EADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEP 78
Query: 72  LEIVLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIIACSVTVDEGSQLKPXXXXXXXX 131
           LEI+LHLPLLCEDKNVPYVFVRSKQALGRACGVSRP+IACSVT+ EGSQLK         
Sbjct: 79  LEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQS 138
Query: 132 XERLLI 137
            ERLL+
Sbjct: 139 IERLLV 144
>pdb|2OZB|A Chain A, Structure Of A Human Prp31-15.5k-U4 Snrna Complex Length = 130 Back     alignment and structure
>pdb|1E7K|A Chain A, Crystal Structure Of The Spliceosomal 15.5kd Protein Bound To A U4 Snrna Fragment Length = 128 Back     alignment and structure
>pdb|1ZWZ|A Chain A, Structural Comparison Of Yeast Snornp And Splicesomal Protein Snu13p With Its Homologs Length = 126 Back     alignment and structure
>pdb|2ALE|A Chain A, Crystal Structure Of Yeast Rna Splicing Factor Snu13p Length = 134 Back     alignment and structure
>pdb|2AIF|A Chain A, Crystal Structure Of High Mobility Like Protein, Nhp2, Putative From Cryptosporidium Parvum Length = 135 Back     alignment and structure
>pdb|3O85|A Chain A, Giardia Lamblia 15.5kd Rna Binding Protein Length = 122 Back     alignment and structure
>pdb|3PAF|A Chain A, M. Jannaschii L7ae Mutant Length = 117 Back     alignment and structure
>pdb|1RLG|A Chain A, Molecular Basis Of Box CD RNA-Protein Interaction: Co- Crystal Structure Of The Archaeal Srnp Intiation Complex Length = 119 Back     alignment and structure
>pdb|3ID5|C Chain C, Crystal Structure Of Sulfolobus Solfataricus CD RNP ASSEMBLED WITH Nop5, Fibrillarin, L7ae And A Split Half CD RNA Length = 130 Back     alignment and structure
>pdb|2FC3|A Chain A, Crystal Structure Of The Extremely Thermostable Aeropyrum Pernix L7ae Multifunctional Protein Length = 124 Back     alignment and structure
>pdb|1RA4|A Chain A, Crystal Structure Of The Methanococcus Jannaschii L7ae Protein Length = 120 Back     alignment and structure
>pdb|1SDS|A Chain A, Structure Of Protein L7ae Bound To A K-Turn Derived From An Archaeal Box HACA SRNA Length = 117 Back     alignment and structure
>pdb|2LBX|A Chain A, Solution Structure Of The S. Cerevisiae HACA RNP PROTEIN NHP2P Length = 121 Back     alignment and structure
>pdb|2LBW|A Chain A, Solution Structure Of The S. Cerevisiae HACA RNP PROTEIN NHP2P-S82w Mutant Length = 121 Back     alignment and structure
>pdb|1PXW|A Chain A, Crystal Structure Of L7ae Srnp Core Protein From Pyrococcus Abyssii Length = 128 Back     alignment and structure
>pdb|3LWO|C Chain C, Structure Of HACA RNP BOUND TO A SUBSTRATE RNA CONTAINING 5BRU Length = 123 Back     alignment and structure
>pdb|3NMU|C Chain C, Crystal Structure Of Substrate-Bound Halfmer Box CD RNP Length = 129 Back     alignment and structure
>pdb|2HVY|D Chain D, Crystal Structure Of An HACA BOX RNP FROM PYROCOCCUS FURIOSUS Length = 130 Back     alignment and structure
>pdb|2CZW|A Chain A, Crystal Structure Analysis Of Protein Component Ph1496p Of P.Horikoshii Ribonuclease P Length = 124 Back     alignment and structure
>pdb|3HJW|C Chain C, Structure Of A Functional Ribonucleoprotein Pseudouridine Synthase Bound To A Substrate Rna Length = 120 Back     alignment and structure
>pdb|1S72|F Chain F, Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 120 Back     alignment and structure
>pdb|3G4S|F Chain F, Co-Crystal Structure Of Tiamulin Bound To The Large Ribosomal Subunit Length = 119 Back     alignment and structure
>pdb|1FFK|E Chain E, Crystal Structure Of The Large Ribosomal Subunit From Haloarcula Marismortui At 2.4 Angstrom Resolution Length = 119 Back     alignment and structure
>pdb|4A17|F Chain F, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 5s Rrna, 5.8s Rrna And Proteins Of Molecule 2. Length = 255 Back     alignment and structure
>pdb|3ZF7|XX Chain x, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 276 Back     alignment and structure
>pdb|3IZR|H Chain H, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 258 Back     alignment and structure
>pdb|2ZKR|FF Chain f, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 266 Back     alignment and structure
>pdb|3JYW|G Chain G, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 113 Back     alignment and structure
>pdb|1S1I|G Chain G, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h Length = 119 Back     alignment and structure
>pdb|3IZS|H Chain H, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 256 Back     alignment and structure
>pdb|3V7E|A Chain A, Crystal Structure Of Ybxf Bound To The Sam-I Riboswitch Aptamer Length = 82 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query137
2ale_A134 SNU13, NHP2/L7AE family protein YEL026W; splicing, 1e-49
2aif_A135 Ribosomal protein L7A; high-mobility like protein, 4e-49
2jnb_A144 NHP2-like protein 1; splicing, KINK-turn RNA-bindi 5e-49
3o85_A122 Ribosomal protein L7AE; alpha beta sandwich fold, 8e-44
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 3e-36
1vq8_F120 50S ribosomal protein L7AE; ribosome 50S, protein- 8e-36
2lbw_A121 H/ACA ribonucleoprotein complex subunit 2; L7AE, s 8e-36
1rlg_A119 50S ribosomal protein L7AE; protein-RNA, structura 1e-34
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 6e-32
3v7e_A82 Ribosome-associated protein L7AE-like; RNA-protein 2e-29
2xzm_U126 Ribosomal protein L7AE containing protein; ribosom 3e-27
3izc_H256 60S ribosomal protein RPL8 (L7AE); eukaryotic ribo 5e-27
3jyw_G113 60S ribosomal protein L8(A); eukaryotic ribosome, 6e-26
4a17_F255 RPL7A, 60S ribosomal protein L9; eukaryotic riboso 2e-22
2zkr_f266 60S ribosomal protein L7A; protein-RNA complex, 60 5e-21
3iz5_H258 60S ribosomal protein L7A (L7AE); eukaryotic ribos 2e-20
3u5c_M143 40S ribosomal protein S12, 40S ribosomal protein S 2e-16
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 6e-15
3on1_A101 BH2414 protein; structural genomics, PSI-2, protei 6e-13
3u5e_c105 L32, RP73, YL38, 60S ribosomal protein L30; transl 8e-12
3vi6_A125 60S ribosomal protein L30; three-layer alpha/beta/ 8e-12
4a18_G104 RPL30; ribosome, eukaryotic initiation factor 6, E 4e-11
3iz5_F190 60S ribosomal protein L9 (L6P); eukaryotic ribosom 4e-11
3cpq_A110 50S ribosomal protein L30E; RNA-protein, elongatio 2e-10
1w41_A101 50S ribosomal protein L30E; electrostatic interact 6e-10
>2ale_A SNU13, NHP2/L7AE family protein YEL026W; splicing, RNA, yeast, His-TAG, RNA binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: d.79.3.1 PDB: 1zwz_A 2ozb_A 3siu_A 3siv_A 1e7k_A Length = 134 Back     alignment and structure
 Score =  154 bits (390), Expect = 1e-49
 Identities = 88/125 (70%), Positives = 107/125 (85%)

Query: 13  PAVNPKAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEPL 72
            A NPKA+PLAD ALT +IL +VQQA N +QL+KGANEATKTLNRG+SEFI++AAD EP+
Sbjct: 2   SAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPI 61

Query: 73  EIVLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIIACSVTVDEGSQLKPQIQAIQQQI 132
           EI+LHLPLLCEDKNVPYVFV S+ ALGRACGVSRP+IA S+T ++ S +K QI A++ +I
Sbjct: 62  EILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKI 121

Query: 133 ERLLI 137
           E LLI
Sbjct: 122 ETLLI 126
>2aif_A Ribosomal protein L7A; high-mobility like protein, transcription factor, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum} SCOP: d.79.3.1 Length = 135 Back     alignment and structure
>2jnb_A NHP2-like protein 1; splicing, KINK-turn RNA-binding protein, NHPX, RNA binding protein; NMR {Homo sapiens} SCOP: d.79.3.1 Length = 144 Back     alignment and structure
>3o85_A Ribosomal protein L7AE; alpha beta sandwich fold, K-turn RNA binding protein, KINK T ribosomal protein; 1.81A {Giardia lamblia} Length = 122 Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Length = 124 Back     alignment and structure
>1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... Length = 120 Back     alignment and structure
>2lbw_A H/ACA ribonucleoprotein complex subunit 2; L7AE, snoRNP, scaRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} PDB: 2lbx_A Length = 121 Back     alignment and structure
>1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 Length = 119 Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Length = 120 Back     alignment and structure
>3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} Length = 82 Back     alignment and structure
>2xzm_U Ribosomal protein L7AE containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_U Length = 126 Back     alignment and structure
>3jyw_G 60S ribosomal protein L8(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_G Length = 113 Back     alignment and structure
>4a17_F RPL7A, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_F 4a1c_F 4a1e_F Length = 255 Back     alignment and structure
>2zkr_f 60S ribosomal protein L7A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 266 Back     alignment and structure
>3u5c_M 40S ribosomal protein S12, 40S ribosomal protein S11-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_M Length = 143 Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Length = 101 Back     alignment and structure
>3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} Length = 101 Back     alignment and structure
>3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 Length = 105 Back     alignment and structure
>3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C Length = 125 Back     alignment and structure
>4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 Length = 104 Back     alignment and structure
>3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} Length = 110 Back     alignment and structure
>1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A Length = 101 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query137
2ale_A134 SNU13, NHP2/L7AE family protein YEL026W; splicing, 100.0
2jnb_A144 NHP2-like protein 1; splicing, KINK-turn RNA-bindi 100.0
3o85_A122 Ribosomal protein L7AE; alpha beta sandwich fold, 100.0
2aif_A135 Ribosomal protein L7A; high-mobility like protein, 100.0
2lbw_A121 H/ACA ribonucleoprotein complex subunit 2; L7AE, s 99.96
1vq8_F120 50S ribosomal protein L7AE; ribosome 50S, protein- 99.95
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 99.95
1rlg_A119 50S ribosomal protein L7AE; protein-RNA, structura 99.94
3u5e_c105 L32, RP73, YL38, 60S ribosomal protein L30; transl 99.93
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 99.93
4a18_G104 RPL30; ribosome, eukaryotic initiation factor 6, E 99.93
3cpq_A110 50S ribosomal protein L30E; RNA-protein, elongatio 99.93
3on1_A101 BH2414 protein; structural genomics, PSI-2, protei 99.92
3iz5_f112 60S ribosomal protein L30 (L30E); eukaryotic ribos 99.92
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 99.92
1w41_A101 50S ribosomal protein L30E; electrostatic interact 99.92
3j21_Z99 50S ribosomal protein L30E; archaea, archaeal, KIN 99.91
2xzm_U126 Ribosomal protein L7AE containing protein; ribosom 99.91
3v7e_A82 Ribosome-associated protein L7AE-like; RNA-protein 99.91
3u5c_M143 40S ribosomal protein S12, 40S ribosomal protein S 99.9
3vi6_A125 60S ribosomal protein L30; three-layer alpha/beta/ 99.86
2kg4_A165 Growth arrest and DNA-damage-inducible protein GA 99.85
3jyw_G113 60S ribosomal protein L8(A); eukaryotic ribosome, 99.83
4a17_F255 RPL7A, 60S ribosomal protein L9; eukaryotic riboso 99.8
2zkr_f266 60S ribosomal protein L7A; protein-RNA complex, 60 99.79
3izc_H256 60S ribosomal protein RPL8 (L7AE); eukaryotic ribo 99.79
3iz5_H258 60S ribosomal protein L7A (L7AE); eukaryotic ribos 99.77
3cg6_A146 Growth arrest and DNA-damage-inducible 45 gamma; a 99.65
3ffm_A167 Growth arrest and DNA-damage-inducible protein GAD 99.52
3ir9_A166 Peptide chain release factor subunit 1; structural 95.6
1x52_A124 Pelota homolog, CGI-17; ERF1_3 domain, structural 94.8
3nk6_A 277 23S rRNA methyltransferase; nosiheptide, nosihepti 93.28
3agk_A373 Peptide chain release factor subunit 1; translatio 92.9
3j15_A357 Protein pelota; ribosome recycling, ribosome, arch 92.66
3oby_A352 Protein pelota homolog; SM fold, hydrolase; 2.90A 92.24
3e20_C441 Eukaryotic peptide chain release factor subunit 1; 92.11
3agj_B358 Protein pelota homolog; GTP binding, translation-h 91.78
3obw_A364 Protein pelota homolog; SM fold, hydrolase; 2.60A 91.58
2qi2_A347 Pelota, cell division protein pelota related prote 91.52
1b93_A152 Protein (methylglyoxal synthase); glycolytic bypas 91.22
3mca_B390 Protein DOM34, elongation factor 1 alpha-like prot 90.5
1gz0_A 253 Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O 90.45
1dt9_A437 ERF1, protein (eukaryotic peptide chain release fa 90.0
2vgn_A386 DOM34; translation termination factor, protein bio 89.69
1vmd_A178 MGS, methylglyoxal synthase; TM1185, structural ge 88.24
2xw6_A134 MGS, methylglyoxal synthase; lyase; 1.08A {Thermus 88.15
1ipa_A 274 RRMH, RNA 2'-O-ribose methyltransferase; DEEP tref 86.91
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 86.47
2ohw_A133 YUEI protein; structural genomics, PSI-2, protein 85.6
2yvq_A143 Carbamoyl-phosphate synthase; conserved hypothetic 83.32
>2ale_A SNU13, NHP2/L7AE family protein YEL026W; splicing, RNA, yeast, His-TAG, RNA binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: d.79.3.1 PDB: 1zwz_A 2ozb_A 3siu_A 3siv_A 1e7k_A Back     alignment and structure
Probab=100.00  E-value=3.1e-35  Score=215.84  Aligned_cols=126  Identities=70%  Similarity=1.078  Sum_probs=120.6

Q ss_pred             CCCCCcccCCCCChHHHHHHHHHHHHHHHcCCccccHHHHHHHHHcCcccEEEEecCCChhhHHHhHHHHhHhcCCCEEE
Q psy1295          12 EPAVNPKAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEPLEIVLHLPLLCEDKNVPYVF   91 (137)
Q Consensus        12 ~~~~~~~~~p~a~~~~~~kl~~lL~~A~~ag~lv~G~~~v~kaI~k~kaklViiA~D~~~~~~~~~i~~lc~~~~IP~i~   91 (137)
                      |..++|+++|||+.+++++++++|++|+++|+++.|.++|+++|++|++++||||+|++|.+++++++.+|++++|||++
T Consensus         1 ~~~~~~~a~p~a~~~~~~ki~~~L~lA~k~gkl~~G~~~v~kai~~gkakLViiA~D~~p~~~~~~l~~lc~~~~VP~~~   80 (134)
T 2ale_A            1 MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVF   80 (134)
T ss_dssp             CCCCCTTCCSBCCHHHHHHHHHHHHHHHHTTCEEESHHHHHHHHHHTCEEEEEEETTCSSGGGGTHHHHHHHHHTCCEEE
T ss_pred             CCCCCccccCCCCHHHHHHHHHHHHHHHHcCCcccCchHHHHHHHhCCCeEEEEeCCCCHHHHHHHHHHHHHhcCCCEEE
Confidence            67799999999999999999999999999999999999999999999999999999999977999999999999999999


Q ss_pred             eCCHHHHHHHhCCCcceEEEEEEeCCCCChHHHHHHHHHHHHHhhC
Q psy1295          92 VRSKQALGRACGVSRPIIACSVTVDEGSQLKPQIQAIQQQIERLLI  137 (137)
Q Consensus        92 ~~tk~eLG~a~G~~~~v~~~ai~~~~~s~~~~~i~e~~~~~~~~~~  137 (137)
                      ++|+.+||+|||+++++++++|.+.+++++.++++++.+++++|++
T Consensus        81 v~sk~eLG~a~G~~~~~s~vaI~d~~~s~~~~l~~~i~~~~~~~~~  126 (134)
T 2ale_A           81 VPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI  126 (134)
T ss_dssp             ESCHHHHHHHTTCSSCCSEEEEECCTTCTTHHHHHHHHHHHHHHHH
T ss_pred             ECCHHHHHHHhCCCCCeEEEEEEcCChHHHHHHHHHHHHHHHHhHH
Confidence            9999999999999998778888888889999999999999999863
>2jnb_A NHP2-like protein 1; splicing, KINK-turn RNA-binding protein, NHPX, RNA binding protein; NMR {Homo sapiens} SCOP: d.79.3.1 Back     alignment and structure
>3o85_A Ribosomal protein L7AE; alpha beta sandwich fold, K-turn RNA binding protein, KINK T ribosomal protein; 1.81A {Giardia lamblia} Back     alignment and structure
>2aif_A Ribosomal protein L7A; high-mobility like protein, transcription factor, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum} SCOP: d.79.3.1 Back     alignment and structure
>2lbw_A H/ACA ribonucleoprotein complex subunit 2; L7AE, snoRNP, scaRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} PDB: 2lbx_A Back     alignment and structure
>1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Back     alignment and structure
>1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 Back     alignment and structure
>3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 4b6a_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Back     alignment and structure
>4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 Back     alignment and structure
>3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Back     alignment and structure
>1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A Back     alignment and structure
>3j21_Z 50S ribosomal protein L30E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2xzm_U Ribosomal protein L7AE containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_U Back     alignment and structure
>3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} Back     alignment and structure
>3u5c_M 40S ribosomal protein S12, 40S ribosomal protein S11-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_M Back     alignment and structure
>3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C Back     alignment and structure
>2kg4_A Growth arrest and DNA-damage-inducible protein GA alpha; GADD45, flexible regions, monomer cycle; NMR {Homo sapiens} Back     alignment and structure
>3jyw_G 60S ribosomal protein L8(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_G Back     alignment and structure
>4a17_F RPL7A, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_F 4a1c_F 4a1e_F Back     alignment and structure
>2zkr_f 60S ribosomal protein L7A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>3cg6_A Growth arrest and DNA-damage-inducible 45 gamma; alpha/beta, cell cycle; 1.70A {Mus musculus} PDB: 2wal_A Back     alignment and structure
>3ffm_A Growth arrest and DNA-damage-inducible protein GADD45 gamma; beta-turn-helix, cell cycle; 2.30A {Homo sapiens} Back     alignment and structure
>3ir9_A Peptide chain release factor subunit 1; structural genomics, APC36528.1, C-terminal domain, PSI-2, protein structure initiative; 2.21A {Methanosarcina mazei} Back     alignment and structure
>1x52_A Pelota homolog, CGI-17; ERF1_3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.79.3.2 Back     alignment and structure
>3nk6_A 23S rRNA methyltransferase; nosiheptide, nosiheptide-resistance methyltransferase, 23S R methyltransferase; 2.00A {Streptomyces actuosus} PDB: 3nk7_A* 3gyq_A* Back     alignment and structure
>3agk_A Peptide chain release factor subunit 1; translation; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3j15_A Protein pelota; ribosome recycling, ribosome, archaea, translation-transport complex; HET: ADP; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3oby_A Protein pelota homolog; SM fold, hydrolase; 2.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3e20_C Eukaryotic peptide chain release factor subunit 1; SUP35, SUP45, translation termination, peptide release, GTP- nucleotide-binding; 3.50A {Schizosaccharomyces pombe} Back     alignment and structure
>3agj_B Protein pelota homolog; GTP binding, translation-hydrolase complex; HET: GTP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>3obw_A Protein pelota homolog; SM fold, hydrolase; 2.60A {Sulfolobus solfataricus} Back     alignment and structure
>2qi2_A Pelota, cell division protein pelota related protein; DOM34, cell cycle; 2.90A {Thermoplasma acidophilum} SCOP: b.38.4.1 c.55.4.2 d.79.3.2 Back     alignment and structure
>1b93_A Protein (methylglyoxal synthase); glycolytic bypass, lyase; 1.90A {Escherichia coli} SCOP: c.24.1.2 PDB: 1egh_A 1ik4_A* 1s8a_A 1s89_A Back     alignment and structure
>3mca_B Protein DOM34, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1gz0_A Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O-methyltransferase, knot, montreal- kingston bacterial structural genomics initiative, BSGI; 2.5A {Escherichia coli} SCOP: c.116.1.1 d.79.3.3 Back     alignment and structure
>1dt9_A ERF1, protein (eukaryotic peptide chain release factor subunit 1); tRNA mimicry, protein sythesis, STOP codon recognition, peptidyl-tRNA hydrolysis; 2.70A {Homo sapiens} SCOP: c.55.4.2 d.79.3.2 d.91.1.1 PDB: 3e1y_A* 2ktu_A 2ktv_A 2lgt_A 2hst_A Back     alignment and structure
>2vgn_A DOM34; translation termination factor, protein biosynthesis, translation regulation, cell division, mRNA degradation; 2.5A {Saccharomyces cerevisiae} SCOP: b.38.4.1 c.55.4.2 d.79.3.2 PDB: 2vgm_A 3izq_0 3j16_A* Back     alignment and structure
>1vmd_A MGS, methylglyoxal synthase; TM1185, structural genomics, JCSG, P structure initiative, PSI, joint center for structural GENO lyase; 2.06A {Thermotoga maritima} SCOP: c.24.1.2 Back     alignment and structure
>2xw6_A MGS, methylglyoxal synthase; lyase; 1.08A {Thermus SP} PDB: 2x8w_A 1wo8_A Back     alignment and structure
>1ipa_A RRMH, RNA 2'-O-ribose methyltransferase; DEEP trefoil knot, rossmann fold, EL30-like fold, riken structural genomics/proteomics initiative; 2.40A {Thermus thermophilus} SCOP: c.116.1.1 d.79.3.3 Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>2ohw_A YUEI protein; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.40A {Bacillus subtilis} SCOP: d.79.8.1 Back     alignment and structure
>2yvq_A Carbamoyl-phosphate synthase; conserved hypothetical protein, structural genomics, NPPSFA; 1.98A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 137
d2alea1126 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein 3e-48
d2ozba1125 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Hu 1e-45
d2aifa1115 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Crypto 2e-39
d1rlga_113 d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Arc 3e-32
d2fc3a1124 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyr 5e-31
d1vqof1119 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeo 2e-30
d1xbia1115 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeo 9e-26
d1w3ex198 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 2e-19
d1t0kb_97 d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L3 2e-19
d2bo1a1100 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L3 5e-17
>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} Length = 126 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: L30e-like
family: L30e/L7ae ribosomal proteins
domain: Small nuclear ribonucleoprotein-associated protein 1, Snu13p
species: Saccharomyces cerevisiae [TaxId: 4932]

 Score =  149 bits (377), Expect = 3e-48
 Identities = 88/124 (70%), Positives = 107/124 (86%)

Query: 14  AVNPKAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEPLE 73
           A NPKA+PLAD ALT +IL +VQQA N +QL+KGANEATKTLNRG+SEFI++AAD EP+E
Sbjct: 3   APNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIE 62

Query: 74  IVLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIIACSVTVDEGSQLKPQIQAIQQQIE 133
           I+LHLPLLCEDKNVPYVFV S+ ALGRACGVSRP+IA S+T ++ S +K QI A++ +IE
Sbjct: 63  ILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIE 122

Query: 134 RLLI 137
            LLI
Sbjct: 123 TLLI 126
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Length = 115 Back     information, alignment and structure
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 113 Back     information, alignment and structure
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Length = 124 Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 119 Back     information, alignment and structure
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 98 Back     information, alignment and structure
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 97 Back     information, alignment and structure
>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 100 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query137
d2alea1126 Small nuclear ribonucleoprotein-associated protein 100.0
d2ozba1125 Spliceosomal 15.5kd protein {Human (Homo sapiens) 100.0
d2aifa1115 Ribosomal protein L7ae {Cryptosporidium parvum [Ta 100.0
d1vqof1119 Ribosomal protein L7ae {Archaeon Haloarcula marism 99.96
d2fc3a1124 Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 5 99.95
d1rlga_113 Ribosomal protein L7ae {Archaeon Archaeoglobus ful 99.95
d1xbia1115 Ribosomal protein L7ae {Archaeon Methanococcus jan 99.92
d1w3ex198 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 99.91
d1t0kb_97 Eukaryotic ribosomal protein L30 (L30e) {Baker's y 99.91
d2bo1a1100 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 99.9
d1gz0a276 RlmB, N-terminal domain {Escherichia coli [TaxId: 97.05
d1dt9a2146 C-terminal domain of eukaryotic peptide chain rele 96.21
d2vgna3104 Dom34 {Saccharomyces cerevisiae [TaxId: 4932]} 95.78
d1x52a1111 Cell division protein pelota {Human (Homo sapiens) 95.77
d2qi2a395 Cell division protein pelota {Thermoplasma acidoph 95.66
d1ipaa2105 RrmA (RrmH), N-terminal domain {Thermus thermophil 90.32
d1b93a_148 Methylglyoxal synthase, MgsA {Escherichia coli [Ta 88.04
d1wo8a1126 Methylglyoxal synthase, MgsA {Thermus thermophilus 87.5
d1vmda_156 Methylglyoxal synthase, MgsA {Thermotoga maritima 86.12
d1knxa1132 HPr kinase/phoshatase HprK N-terminal domain {Myco 85.24
d1ko7a1129 HPr kinase/phoshatase HprK N-terminal domain {Stap 83.97
d2ohwa1128 Uncharacterized protein YueI {Bacillus subtilis [T 81.32
>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: L30e-like
family: L30e/L7ae ribosomal proteins
domain: Small nuclear ribonucleoprotein-associated protein 1, Snu13p
species: Saccharomyces cerevisiae [TaxId: 4932]

Probab=100.00  E-value=7.1e-36  Score=215.51  Aligned_cols=126  Identities=70%  Similarity=1.078  Sum_probs=122.0

Q ss_pred             CCCCCcccCCCCChHHHHHHHHHHHHHHHcCCccccHHHHHHHHHcCcccEEEEecCCChhhHHHhHHHHhHhcCCCEEE
Q psy1295          12 EPAVNPKAYPLADTALTTKILSLVQQALNYKQLRKGANEATKTLNRGLSEFIVLAADAEPLEIVLHLPLLCEDKNVPYVF   91 (137)
Q Consensus        12 ~~~~~~~~~p~a~~~~~~kl~~lL~~A~~ag~lv~G~~~v~kaI~k~kaklViiA~D~~~~~~~~~i~~lc~~~~IP~i~   91 (137)
                      |.++.|+++|+|++++++++++++++|+++|++++|.++|+++|++|++++||+|+|++|.++.+|++.+|++++|||++
T Consensus         1 ~~~~~~~a~P~a~~~l~~~i~~ll~~a~~~~~l~~G~~ev~K~i~~g~a~lVviA~D~~p~~~~~~l~~lc~~~~Ip~~~   80 (126)
T d2alea1           1 MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVF   80 (126)
T ss_dssp             CCCCCTTCCSBCCHHHHHHHHHHHHHHHHTTCEEESHHHHHHHHHHTCEEEEEEETTCSSGGGGTHHHHHHHHHTCCEEE
T ss_pred             CCCCCCccCCCCCHHHHHHHHHHHHHHHHcCCcccCHHHHHHHHHcCCCeEEEEeCCCChHHHHHHHHHHHhccCCCEEE
Confidence            67889999999999999999999999999999999999999999999999999999999988999999999999999999


Q ss_pred             eCCHHHHHHHhCCCcceEEEEEEeCCCCChHHHHHHHHHHHHHhhC
Q psy1295          92 VRSKQALGRACGVSRPIIACSVTVDEGSQLKPQIQAIQQQIERLLI  137 (137)
Q Consensus        92 ~~tk~eLG~a~G~~~~v~~~ai~~~~~s~~~~~i~e~~~~~~~~~~  137 (137)
                      ++|+.+||+|||++++++++++..++.+++.+.++++.+++++|.+
T Consensus        81 v~sk~~LG~a~G~~~~~~~~~i~~~~~~~~~~~~~~i~~~i~~L~~  126 (126)
T d2alea1          81 VPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI  126 (126)
T ss_dssp             ESCHHHHHHHTTCSSCCSEEEEECCTTCTTHHHHHHHHHHHHHHHH
T ss_pred             ECchhHHHHHhCCCCCeEEEEEeccchHHHHHHHHHHHHHHHhhcC
Confidence            9999999999999999999999999999999999999999999964
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d1gz0a2 d.79.3.3 (A:2-77) RlmB, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dt9a2 d.79.3.2 (A:277-422) C-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vgna3 d.79.3.2 (A:278-381) Dom34 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1x52a1 d.79.3.2 (A:8-118) Cell division protein pelota {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qi2a3 d.79.3.2 (A:244-338) Cell division protein pelota {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ipaa2 d.79.3.3 (A:1-105) RrmA (RrmH), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b93a_ c.24.1.2 (A:) Methylglyoxal synthase, MgsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wo8a1 c.24.1.2 (A:1-126) Methylglyoxal synthase, MgsA {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vmda_ c.24.1.2 (A:) Methylglyoxal synthase, MgsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1knxa1 c.98.2.1 (A:1-132) HPr kinase/phoshatase HprK N-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1ko7a1 c.98.2.1 (A:1-129) HPr kinase/phoshatase HprK N-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2ohwa1 d.79.8.1 (A:3-130) Uncharacterized protein YueI {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure