Diaphorina citri psyllid: psy12968

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400--

MDIERELEDGNDTKANEYVKTLLKEKMTLDSDSHSYTLKLLDDEINKAMASNKKKYDSPYLDLFREKPILVKVKVLVPVKEHPRFNFVGKLLGPKGNSLRRLQEETMTKMSILGKGSMRDRSKEEELRKEGDPKNAHLVEDLHVQVSALAPPAEAHARIAYALSELRKYIIPDVNDEIRQEQFREMGYVHHEPRPQMRHPRPPPHMVAARPAPGLLAPPRMQHAAPPHMVRPPHPPPPPAASRGKVLSILDRARAAMEKPAPSAGVYEYEDPHAAHAYYETTASYDPAMYDPYASTAGDYYDTSASYYETAAPAPLPSTSSRTGGSGWKSSSGYAEHHSSSRSKSSAPIRSSSSEKVVNASLVGLQGAQSTEYGYEDRKRRLDPYSDVESKKFVGSRVVKYK

cccHHHccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEEcccccccccccEEECcccccHHHHHHHHHccEEEEccccccccccHHHHHHccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcc

********************TLLKEKMTLDSDSHSYTLKLLDDEIN*********YDSPYLDLFREKPILVKVKVLVPVKEHPRFNFVGKLLGPKGNSLRRLQEETMTKMSIL************************LVEDLHVQVSALAPPAEAHARIAYALSELRKYIIPDVNDEIRQEQFREM*******************************************************************************VYEYEDPHAAHAYYETTASYDPAMYDPYASTAGDYYDTSASYY*******************************************************************************VESKKFVGSRVVKY*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
KH domain-containing, RNA-binding, signal transduction-associated protein 3	RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. May play a role as a negative regulator of cell growth. Inhibits cell proliferation. Involved in splice site selection of vascular endothelial growth factor. Induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. RNA-binding abilities are down-regulated by tyrosine kinase PTK6. Binds preferentially to the 5'-[AU]UAAA-3' motif in vitro.	confident	Q9R226
KH domain-containing, RNA-binding, signal transduction-associated protein 3	RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. May play a role as a negative regulator of cell growth. Inhibits cell proliferation. Involved in splice site selection of vascular endothelial growth factor. Induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. RNA-binding abilities are down-regulated by tyrosine kinase PTK6. Involved in post-transcriptional regulation of HIV-1 gene expression. Binds preferentially to the 5'-[AU]UAAA-3' motif in vitro.	confident	O75525
KH domain-containing, RNA-binding, signal transduction-associated protein 3	RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. May play a role as a negative regulator of cell growth. Inhibits cell proliferation. Involved in splice site selection of vascular endothelial growth factor. Induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. RNA-binding abilities are down-regulated by tyrosine kinase PTK6. Binds preferentially to the 5'-[AU]UAAA-3' motif in vitro.	confident	Q9JLP1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016607 [CC]	nuclear speck	probable	GO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0071011 [CC]	precatalytic spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]	catalytic step 2 spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0017124 [MF]	SH3 domain binding	probable	GO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0044763 [BP]	single-organism cellular process	probable	GO:0009987, GO:0008150, GO:0044699
GO:0046982 [MF]	protein heterodimerization activity	probable	GO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0042169 [MF]	SH2 domain binding	probable	GO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0006397 [BP]	mRNA processing	probable	GO:0016070, GO:0016071, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0031325 [BP]	positive regulation of cellular metabolic process	probable	GO:0009893, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0051252 [BP]	regulation of RNA metabolic process	probable	GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0050794, GO:0019219, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0010604 [BP]	positive regulation of macromolecule metabolic process	probable	GO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0008143 [MF]	poly(A) RNA binding	probable	GO:0005488, GO:0097159, GO:0070717, GO:0003727, GO:0003674, GO:0003723, GO:0003676, GO:1901363, GO:0003729
GO:0008266 [MF]	poly(U) RNA binding	probable	GO:0097159, GO:0003727, GO:0003674, GO:0003723, GO:0003676, GO:0008187, GO:1901363, GO:0005488
GO:0010468 [BP]	regulation of gene expression	probable	GO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BL5, chain A
Confidence level:very confident
Coverage over the Query: 70-196
View the alignment between query and template
View the model in PyMOL

Template: 3K6T, chain A
Confidence level:probable
Coverage over the Query: 12-52
View the alignment between query and template
View the model in PyMOL